BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00194 (762 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6LFD2 Cluster: Putative syntaxin binding protein; n=1;... 36 0.83 UniRef50_A7HNQ7 Cluster: Response regulator receiver modulated m... 34 3.3 UniRef50_Q8D271 Cluster: YtfM protein; n=1; Wigglesworthia gloss... 33 5.8 UniRef50_Q54GT5 Cluster: Putative uncharacterized protein; n=1; ... 33 5.8 >UniRef50_Q6LFD2 Cluster: Putative syntaxin binding protein; n=1; Plasmodium falciparum 3D7|Rep: Putative syntaxin binding protein - Plasmodium falciparum (isolate 3D7) Length = 703 Score = 36.3 bits (80), Expect = 0.83 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -2 Query: 719 LKLTNFSYNEFCKPLTNINNVVMYKFSNKIFIEMQNHLLYSNVINNTF 576 L + ++SY C L NIN + +F E N +YSN N+T+ Sbjct: 269 LFIHDYSYQSLCYDLLNINTIYEMQFDQTKINEQPNEHIYSNTCNDTY 316 >UniRef50_A7HNQ7 Cluster: Response regulator receiver modulated metal dependent phosphohydrolase; n=1; Fervidobacterium nodosum Rt17-B1|Rep: Response regulator receiver modulated metal dependent phosphohydrolase - Fervidobacterium nodosum Rt17-B1 Length = 471 Score = 34.3 bits (75), Expect = 3.3 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -2 Query: 692 EFCKPLTNINNVVMYKFSNKIFIEMQNHLLYSNVINNTFKII 567 EF KP I ++ F K + M+NHLL ++I+ +KI+ Sbjct: 244 EFSKPFDEIYKNLIEMFFEKFVLVMENHLLTQDLIDTLYKIV 285 >UniRef50_Q8D271 Cluster: YtfM protein; n=1; Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis|Rep: YtfM protein - Wigglesworthia glossinidia brevipalpis Length = 579 Score = 33.5 bits (73), Expect = 5.8 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = -2 Query: 761 SNLNVQRNSLIL*PLKLTNFSYNEFCKPLTNINNVVMYKFSNKIFIEMQNHLLYSNVINN 582 +N +++ LI ++ +Y+E P +N + SNKIF N + +NN Sbjct: 378 NNFKIKKKILIYPSFQINKINYDEISFPFFGLNQNYEFNLSNKIFGSSVNFFMLK--VNN 435 Query: 581 TF 576 TF Sbjct: 436 TF 437 >UniRef50_Q54GT5 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 452 Score = 33.5 bits (73), Expect = 5.8 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = -1 Query: 330 NKAETVESSRNNIKPSGPTPYL*QKPANFILTQQLRVSPQDMQANSHTRWTRDKCI 163 N+ + ++ NN KP P Q+ + +I QQ R+ PQ Q ++W DK + Sbjct: 248 NQPYNINNNNNNNKPPPPIQLPPQQSSQYIGNQQ-RLPPQQYQNEQKSKWWLDKLV 302 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 631,081,581 Number of Sequences: 1657284 Number of extensions: 12282017 Number of successful extensions: 28085 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 26923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28074 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 63381147830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -