BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00194 (762 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC057765-1|AAH57765.1| 476|Homo sapiens HtrA serine peptidase 4... 30 7.8 AK075205-1|BAC11470.1| 476|Homo sapiens protein ( Homo sapiens ... 30 7.8 >BC057765-1|AAH57765.1| 476|Homo sapiens HtrA serine peptidase 4 protein. Length = 476 Score = 30.3 bits (65), Expect = 7.8 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +3 Query: 99 QTTSPDVCSPTRSPE-SECARSKCTYHVSTVCDCLPACPA 215 Q + P VC PTR P CA T V +C C CPA Sbjct: 37 QPSCPAVCQPTRCPALPTCALG--TTPVFDLCRCCRVCPA 74 >AK075205-1|BAC11470.1| 476|Homo sapiens protein ( Homo sapiens cDNA FLJ90724 fis, clone PLACE1009279, highly similar to Probable serine protease HTRA4 precursor (EC3.4.21.-). ). Length = 476 Score = 30.3 bits (65), Expect = 7.8 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +3 Query: 99 QTTSPDVCSPTRSPE-SECARSKCTYHVSTVCDCLPACPA 215 Q + P VC PTR P CA T V +C C CPA Sbjct: 37 QPSCPAVCQPTRCPALPTCALG--TTPVFDLCRCCRVCPA 74 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,224,102 Number of Sequences: 237096 Number of extensions: 1847954 Number of successful extensions: 3347 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3344 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9144232952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -