BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00193 (718 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 5.7 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 5.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 5.7 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 7.6 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 533 LAPCSNPHRKSTPTIRELRTL 595 L PC++P+RK LR L Sbjct: 130 LTPCASPNRKPDDNQDHLRRL 150 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 5.7 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +3 Query: 153 HKEALLHNAPPDMVGIPGRNTS*LMAASRSKLRPPL 260 H L PP +GIP A S RPP+ Sbjct: 129 HNGDPLSQPPPAHMGIPPYQLDSKTAGSMGLTRPPM 164 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 5.7 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +3 Query: 153 HKEALLHNAPPDMVGIPGRNTS*LMAASRSKLRPPL 260 H L PP +GIP A S RPP+ Sbjct: 21 HNGDPLSQPPPAHMGIPPYQLDSKTAGSMGLTRPPM 56 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 289 DFICEQTRCYYYNY 330 DF+C T Y+ NY Sbjct: 145 DFLCRHTVEYFQNY 158 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,178 Number of Sequences: 336 Number of extensions: 3421 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -