BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00193 (718 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 24 1.7 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 24 1.7 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 24 1.7 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 24 1.7 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 6.7 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 8.8 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 8.8 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 23.8 bits (49), Expect = 1.7 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 191 HVGRCVVEQCFLVVRLEGPCC 129 H+G ++ L++ L G CC Sbjct: 57 HIGLAIIYSMLLIMSLVGNCC 77 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.8 bits (49), Expect = 1.7 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +2 Query: 467 LNNLIGKLRPSSLDASSLHTSRLAPCSNPHRKSTPTIRELRTL 595 L+ L+ K+R +D + L R NP + +I+E+ L Sbjct: 316 LSELVSKMREMKMDRTELGCLRSIILFNPEVRGLKSIQEVTLL 358 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.8 bits (49), Expect = 1.7 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +2 Query: 467 LNNLIGKLRPSSLDASSLHTSRLAPCSNPHRKSTPTIRELRTL 595 L+ L+ K+R +D + L R NP + +I+E+ L Sbjct: 316 LSELVSKMREMKMDRTELGCLRSIILFNPEVRGLKSIQEVTLL 358 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 23.8 bits (49), Expect = 1.7 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 191 HVGRCVVEQCFLVVRLEGPCC 129 H+G ++ L++ L G CC Sbjct: 57 HIGLAIIYSMLLIMSLVGNCC 77 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 106 IDGQSPHVVKSRIKWQTGA 50 I+ S H K R++W TGA Sbjct: 134 IESFSYHKQKLRLRWGTGA 152 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 8.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 66 NGRPVLIHKNMSVPRLLPDVQ 4 NGR I + M+ RLLP V+ Sbjct: 28 NGREDQIPREMNTERLLPYVE 48 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 8.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 66 NGRPVLIHKNMSVPRLLPDVQ 4 NGR I + M+ RLLP V+ Sbjct: 28 NGREDQIPREMNTERLLPYVE 48 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,095 Number of Sequences: 438 Number of extensions: 3926 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -