BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00192 (731 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces... 27 3.6 SPCP1E11.11 |||Puf family RNA-binding protein|Schizosaccharomyce... 25 8.4 SPAPB1E7.06c |eme1||Holliday junction resolvase subunit Eme1|Sch... 25 8.4 >SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 3699 Score = 26.6 bits (56), Expect = 3.6 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +3 Query: 99 RYIGSPLALNPKTVRTRCF-FFLPKLIALRGY 191 RY+ LALN +T R RC F++P +I L + Sbjct: 3382 RYLNDALALNCET-RRRCLKFYIPAVIPLSSH 3412 >SPCP1E11.11 |||Puf family RNA-binding protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 642 Score = 25.4 bits (53), Expect = 8.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 45 IRAGGTDQRETFCHDLADRYI 107 ++ G QRET C +LA Y+ Sbjct: 183 VKFGSKQQRETICAELAGSYV 203 >SPAPB1E7.06c |eme1||Holliday junction resolvase subunit Eme1|Schizosaccharomyces pombe|chr 1|||Manual Length = 738 Score = 25.4 bits (53), Expect = 8.4 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 33 CTKIIRAGGTDQRETFCHDLADRYIGSPLAL 125 C I+ DQ +TF H++++++ G L L Sbjct: 517 CRDFIKYIEEDQADTFFHEMSEKFKGCKLIL 547 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,685,471 Number of Sequences: 5004 Number of extensions: 49800 Number of successful extensions: 122 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -