BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00191 (700 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL034550-3|CAI42261.1| 436|Homo sapiens chromosome 20 open read... 59 1e-08 AK056286-1|BAB71138.1| 436|Homo sapiens protein ( Homo sapiens ... 59 1e-08 CR456730-1|CAG33011.1| 422|Homo sapiens NOL4 protein. 59 2e-08 BT006763-1|AAP35409.1| 422|Homo sapiens nucleolar protein 4 pro... 59 2e-08 BC000313-1|AAH00313.1| 422|Homo sapiens NOL4 protein protein. 59 2e-08 AB017800-1|BAA34576.1| 524|Homo sapiens nolp protein. 59 2e-08 AB015339-1|BAA34797.1| 303|Homo sapiens HRIHFB2255 protein. 59 2e-08 AF327442-1|AAL37427.1| 4024|Homo sapiens ciliary dynein heavy ch... 30 9.1 AC104600-1|AAY24051.1| 1270|Homo sapiens unknown protein. 30 9.1 AB023161-1|BAA76788.2| 4031|Homo sapiens KIAA0944 protein protein. 30 9.1 >AL034550-3|CAI42261.1| 436|Homo sapiens chromosome 20 open reading frame 112 protein. Length = 436 Score = 59.3 bits (137), Expect = 1e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 97 KLSGPEVGAVRQLITGYRESAAFLLRSADELETLLLNQ 210 +LS E+ AVRQLI GYRESAAFLLRSADELE L+L Q Sbjct: 398 QLSPTEISAVRQLIAGYRESAAFLLRSADELENLILQQ 435 >AK056286-1|BAB71138.1| 436|Homo sapiens protein ( Homo sapiens cDNA FLJ31724 fis, clone NT2RI2006703, moderately similar to Homo sapiens nolp mRNA. ). Length = 436 Score = 59.3 bits (137), Expect = 1e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 97 KLSGPEVGAVRQLITGYRESAAFLLRSADELETLLLNQ 210 +LS E+ AVRQLI GYRESAAFLLRSADELE L+L Q Sbjct: 398 QLSPTEISAVRQLIAGYRESAAFLLRSADELENLILQQ 435 >CR456730-1|CAG33011.1| 422|Homo sapiens NOL4 protein. Length = 422 Score = 58.8 bits (136), Expect = 2e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 97 KLSGPEVGAVRQLITGYRESAAFLLRSADELETLLLNQ 210 +LS E+ AVRQL+ GYRESAAFLLRSADELE L+L Q Sbjct: 384 QLSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQ 421 >BT006763-1|AAP35409.1| 422|Homo sapiens nucleolar protein 4 protein. Length = 422 Score = 58.8 bits (136), Expect = 2e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 97 KLSGPEVGAVRQLITGYRESAAFLLRSADELETLLLNQ 210 +LS E+ AVRQL+ GYRESAAFLLRSADELE L+L Q Sbjct: 384 QLSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQ 421 >BC000313-1|AAH00313.1| 422|Homo sapiens NOL4 protein protein. Length = 422 Score = 58.8 bits (136), Expect = 2e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 97 KLSGPEVGAVRQLITGYRESAAFLLRSADELETLLLNQ 210 +LS E+ AVRQL+ GYRESAAFLLRSADELE L+L Q Sbjct: 384 QLSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQ 421 >AB017800-1|BAA34576.1| 524|Homo sapiens nolp protein. Length = 524 Score = 58.8 bits (136), Expect = 2e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 97 KLSGPEVGAVRQLITGYRESAAFLLRSADELETLLLNQ 210 +LS E+ AVRQL+ GYRESAAFLLRSADELE L+L Q Sbjct: 486 QLSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQ 523 >AB015339-1|BAA34797.1| 303|Homo sapiens HRIHFB2255 protein. Length = 303 Score = 58.8 bits (136), Expect = 2e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 97 KLSGPEVGAVRQLITGYRESAAFLLRSADELETLLLNQ 210 +LS E+ AVRQL+ GYRESAAFLLRSADELE L+L Q Sbjct: 265 QLSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQ 302 >AF327442-1|AAL37427.1| 4024|Homo sapiens ciliary dynein heavy chain 7 protein. Length = 4024 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 112 EVGAVRQLITGYRESAAFLLRSADELETLL 201 E AV +I YRE+ F+L S DE++ LL Sbjct: 911 EWDAVEFVIHSYRETGTFILASVDEIQMLL 940 >AC104600-1|AAY24051.1| 1270|Homo sapiens unknown protein. Length = 1270 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 112 EVGAVRQLITGYRESAAFLLRSADELETLL 201 E AV +I YRE+ F+L S DE++ LL Sbjct: 906 EWDAVEFVIHSYRETGTFILASVDEIQMLL 935 >AB023161-1|BAA76788.2| 4031|Homo sapiens KIAA0944 protein protein. Length = 4031 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 112 EVGAVRQLITGYRESAAFLLRSADELETLL 201 E AV +I YRE+ F+L S DE++ LL Sbjct: 918 EWDAVEFVIHSYRETGTFILASVDEIQMLL 947 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,884,495 Number of Sequences: 237096 Number of extensions: 1566415 Number of successful extensions: 1975 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1975 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -