BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00190 (753 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 23 2.6 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 22 4.6 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 8.0 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 415 LPIDDSVEGLTGNLFEVYLKPYFMEAYRPIHLTTPSWSG 531 L +++ E LT Y+ P++ YRP + WSG Sbjct: 235 LEVNERKENLTCQPAVPYV-PFYRYCYRPYPVYNQWWSG 272 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 Query: 137 WVCPCDGGSRSINHQDFYYLPFYS 66 W+C + S ++FYYLP S Sbjct: 49 WICALVNYNVSEISENFYYLPAMS 72 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 525 VRGGMRAVEFKVVETDPSPFCIVAPD 602 +RG R +KV E PSP V+P+ Sbjct: 101 IRGPKRKT-WKVEEDSPSPTSSVSPE 125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,742 Number of Sequences: 336 Number of extensions: 4080 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -