BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00187 (703 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X62320-1|CAA44196.1| 593|Homo sapiens Epithelin 1 & 2 protein. 30 7.0 BT006844-1|AAP35490.1| 438|Homo sapiens granulin protein. 30 7.0 BC010577-1|AAH10577.1| 593|Homo sapiens granulin protein. 30 7.0 BC000324-1|AAH00324.1| 438|Homo sapiens granulin protein. 30 7.0 AY124489-1|AAM94026.1| 593|Homo sapiens PC cell-derived growth ... 30 7.0 AK222522-1|BAD96242.1| 593|Homo sapiens granulin variant protein. 30 7.0 AK023348-1|BAB14535.1| 413|Homo sapiens protein ( Homo sapiens ... 30 7.0 AF055008-1|AAC09359.1| 593|Homo sapiens epithelin 1 and 2 protein. 30 7.0 >X62320-1|CAA44196.1| 593|Homo sapiens Epithelin 1 & 2 protein. Length = 593 Score = 30.3 bits (65), Expect = 7.0 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +3 Query: 21 EGVCS----HRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVL 146 +GVC H C +G CA RG L PR + AL+++L Sbjct: 548 QGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL 593 >BT006844-1|AAP35490.1| 438|Homo sapiens granulin protein. Length = 438 Score = 30.3 bits (65), Expect = 7.0 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +3 Query: 21 EGVCS----HRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVL 146 +GVC H C +G CA RG L PR + AL+++L Sbjct: 393 QGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL 438 >BC010577-1|AAH10577.1| 593|Homo sapiens granulin protein. Length = 593 Score = 30.3 bits (65), Expect = 7.0 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +3 Query: 21 EGVCS----HRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVL 146 +GVC H C +G CA RG L PR + AL+++L Sbjct: 548 QGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL 593 >BC000324-1|AAH00324.1| 438|Homo sapiens granulin protein. Length = 438 Score = 30.3 bits (65), Expect = 7.0 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +3 Query: 21 EGVCS----HRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVL 146 +GVC H C +G CA RG L PR + AL+++L Sbjct: 393 QGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL 438 >AY124489-1|AAM94026.1| 593|Homo sapiens PC cell-derived growth factor protein. Length = 593 Score = 30.3 bits (65), Expect = 7.0 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +3 Query: 21 EGVCS----HRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVL 146 +GVC H C +G CA RG L PR + AL+++L Sbjct: 548 QGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL 593 >AK222522-1|BAD96242.1| 593|Homo sapiens granulin variant protein. Length = 593 Score = 30.3 bits (65), Expect = 7.0 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +3 Query: 21 EGVCS----HRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVL 146 +GVC H C +G CA RG L PR + AL+++L Sbjct: 548 QGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL 593 >AK023348-1|BAB14535.1| 413|Homo sapiens protein ( Homo sapiens cDNA FLJ13286 fis, clone OVARC1001154, highly similar to Homo sapiens clone 24720 epithelin 1 and 2 mRNA. ). Length = 413 Score = 30.3 bits (65), Expect = 7.0 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +3 Query: 21 EGVCS----HRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVL 146 +GVC H C +G CA RG L PR + AL+++L Sbjct: 368 QGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL 413 >AF055008-1|AAC09359.1| 593|Homo sapiens epithelin 1 and 2 protein. Length = 593 Score = 30.3 bits (65), Expect = 7.0 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +3 Query: 21 EGVCS----HRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVL 146 +GVC H C +G CA RG L PR + AL+++L Sbjct: 548 QGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL 593 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,285,123 Number of Sequences: 237096 Number of extensions: 2203801 Number of successful extensions: 4682 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4681 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8119219030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -