BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00179 (690 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1612 + 34773218-34773414,34773655-34773738,34773871-347739... 38 0.008 02_02_0400 + 9836045-9837115,9837474-9838577 29 3.5 >04_04_1612 + 34773218-34773414,34773655-34773738,34773871-34773944, 34774312-34774388,34774491-34774527,34774691-34774776, 34775048-34775107,34775216-34775361,34775780-34775906, 34776164-34776319,34776409-34776519,34776725-34776835, 34777040-34777138,34777316-34777444 Length = 497 Score = 37.9 bits (84), Expect = 0.008 Identities = 14/42 (33%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +2 Query: 116 VHICHVA-RKEEILIIKAAKERGVKVTCEVCPHHLFLNSNDI 238 +HI H++ K + ++K AK+ G +V+ E CPH+L ++ ++ Sbjct: 280 IHIVHLSDAKTSLGLLKDAKQNGARVSVETCPHYLAFSAEEV 321 >02_02_0400 + 9836045-9837115,9837474-9838577 Length = 724 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 388 PPGYPGLETILPLLLNAVHQGRLTIEDLINKFHRN 492 PP YP I PLLLNA G I FH+N Sbjct: 396 PPSYPAW--ITPLLLNAADVGTTNIRYYSPYFHKN 428 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,345,414 Number of Sequences: 37544 Number of extensions: 333812 Number of successful extensions: 813 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 813 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -