BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00178 (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 27 0.35 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 23 4.4 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 5.8 AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility pro... 23 7.6 AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility pro... 23 7.6 AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility pro... 23 7.6 AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility pro... 23 7.6 AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility pro... 23 7.6 AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility pro... 23 7.6 AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility pro... 23 7.6 AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility pro... 23 7.6 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 27.1 bits (57), Expect = 0.35 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 1/85 (1%) Frame = -3 Query: 398 KNPESVTSSTVSPMERTSV-ALTNDTMM*ESYSSSLFRRTVQTAFGDPGALIQPFQQLQD 222 + P + TS V P ++ A+ D + +YS + RR A G P + QP QQ Q Sbjct: 231 EQPRASTSRAVMPPRSEALTAVRGDVVPELTYSEVVRRRYRGKATGKPRSQQQPQQQQQQ 290 Query: 221 HVLVL*GRIVGLSHMPSKLAEYLPQ 147 L + VG++ + + PQ Sbjct: 291 RQLQ--RQAVGIAQHQQQQQQRQPQ 313 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.4 bits (48), Expect = 4.4 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 161 PQVYLACGKGPRSSLRALRHGLEVAEKAVSELQDH 265 P VYL G+GPR + LR G+ A + L H Sbjct: 432 PFVYLPFGEGPRICI-GLRFGMMQARIGLVYLLKH 465 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 5.8 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 444 SVITHCMTTKCRCSSQKS*VS 382 SVIT C T+KC+ S S VS Sbjct: 40 SVITDCDTSKCQPLSNISEVS 60 >AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 130 IRRFVLLDEMDSL 142 >AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 130 IRRFVLLDEMDSL 142 >AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 132 IRRFVLLDEMDSL 144 >AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 132 IRRFVLLDEMDSL 144 >AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 >AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 74 LRNLVLVDEMDSL 112 +R VL+DEMDSL Sbjct: 133 IRRFVLLDEMDSL 145 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 555,232 Number of Sequences: 2352 Number of extensions: 11821 Number of successful extensions: 59 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -