BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00177 (801 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 24 1.6 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 24 1.6 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 24 1.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 6.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 6.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 6.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 6.5 AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 22 6.5 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +1 Query: 508 YSMVHISEETILTALQSSQLRTYDIDYTLPITIEIGAMDRPHQ 636 Y ++ S T TA+ S+ + ++ T+P G+M P+Q Sbjct: 245 YPHLNRSSPTTATAIASATVTIQNVSNTIPPFASRGSMHFPNQ 287 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +1 Query: 508 YSMVHISEETILTALQSSQLRTYDIDYTLPITIEIGAMDRPHQ 636 Y ++ S T TA+ S+ + ++ T+P G+M P+Q Sbjct: 193 YPHLNRSSPTTATAIASATVTIQNVSNTIPPFASRGSMHFPNQ 235 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +1 Query: 508 YSMVHISEETILTALQSSQLRTYDIDYTLPITIEIGAMDRPHQ 636 Y ++ S T TA+ S+ + ++ T+P G+M P+Q Sbjct: 376 YPHLNRSSPTTATAIASATVTIQNVSNTIPPFASRGSMHFPNQ 418 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 140 MVCFTCKS 117 +VCFTCKS Sbjct: 959 LVCFTCKS 966 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 140 MVCFTCKS 117 +VCFTCKS Sbjct: 959 LVCFTCKS 966 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 140 MVCFTCKS 117 +VCFTCKS Sbjct: 959 LVCFTCKS 966 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 140 MVCFTCKS 117 +VCFTCKS Sbjct: 959 LVCFTCKS 966 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 21.8 bits (44), Expect = 6.5 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 538 ILTALQSSQLRTYDIDYTLPITIEIG 615 I+T + + +++ DYTLP+ +G Sbjct: 64 IITRVINEEVKLASGDYTLPVGTTVG 89 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,164 Number of Sequences: 336 Number of extensions: 4555 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -