BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00177 (801 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g65650.1 68414.m07448 ubiquitin carboxyl-terminal hydrolase f... 59 3e-09 At5g16310.1 68418.m01907 ubiquitin carboxyl-terminal hydrolase f... 50 2e-06 At4g17510.1 68417.m02620 ubiquitin carboxyl-terminal hydrolase, ... 34 0.096 At3g58010.1 68416.m06465 expressed protein 29 4.7 At3g43670.1 68416.m04655 copper amine oxidase, putative similar ... 29 4.7 At5g35400.1 68418.m04207 tRNA pseudouridine synthase family prot... 28 6.3 At4g36970.1 68417.m05239 remorin family protein contains Pfam do... 28 8.3 At2g10050.1 68415.m01043 zinc knuckle (CCHC-type) family protein... 28 8.3 At1g05960.1 68414.m00625 expressed protein similar to hypothetic... 28 8.3 >At1g65650.1 68414.m07448 ubiquitin carboxyl-terminal hydrolase family 1 protein similar to 26S proteasome regulatory complex subunit p37A [Drosophila melanogaster] GI:6434962; contains Pfam profile PF01088: Ubiquitin carboxyl-terminal hydrolase, family 1 Length = 330 Score = 59.3 bits (137), Expect = 3e-09 Identities = 29/75 (38%), Positives = 42/75 (56%) Frame = +3 Query: 9 KGWAIGNTPELACAHNSHAIPQARKKTDKNAGVSTGRFTGEAYHFVSLVPINGHLFELDG 188 KG AI N+ + AHNS A P+ ++ A + YHF+S +P++G L+ELDG Sbjct: 118 KGLAINNSDSIRAAHNSFARPEPFVPEEQKAATKDD----DVYHFISYIPVDGVLYELDG 173 Query: 189 LKPYPMDHGPWAADE 233 LK P+ GP D+ Sbjct: 174 LKEGPISLGPCPGDQ 188 >At5g16310.1 68418.m01907 ubiquitin carboxyl-terminal hydrolase family 1 protein similar to 26S proteasome regulatory complex subunit p37A [Drosophila melanogaster] GI:6434962; contains Pfam profile PF01088: Ubiquitin carboxyl-terminal hydrolase, family 1 Length = 334 Score = 49.6 bits (113), Expect = 2e-06 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +3 Query: 3 ENKGWAIGNTPELACAHNSHAIPQARK--KTDKNAGVSTGRFTGEAYHFVSLVPINGHLF 176 E KG AI N + AHN+ A P + ++ A + YH++S +P++G L+ Sbjct: 116 ELKGLAINNNEAIRAAHNTFARPDPSSIMEDEELAAAKNLDEDDDVYHYISYLPVDGILY 175 Query: 177 ELDGLKPYPMDHG 215 ELDGLK P+ G Sbjct: 176 ELDGLKEGPISLG 188 >At4g17510.1 68417.m02620 ubiquitin carboxyl-terminal hydrolase, putative / ubiquitin thiolesterase, putative similar to SP|Q9JKB1 Ubiquitin carboxyl-terminal hydrolase isozyme L3 (EC 3.4.19.12) (UCH- L3) (Ubiquitin thiolesterase L3) {Mus musculus}; contains Pfam profile PF01088: Ubiquitin carboxyl-terminal hydrolase, family 1 Length = 234 Score = 34.3 bits (75), Expect = 0.096 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +3 Query: 138 HFVSLVPINGHLFELDGLKPYPMDHG 215 HF+ L + G L+ELDG K P+ HG Sbjct: 172 HFICLACVEGELYELDGRKAGPISHG 197 >At3g58010.1 68416.m06465 expressed protein Length = 308 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -1 Query: 339 LSGTTAIRLNLIS*TCSPASLPSLSAITL 253 +SGT+A+RL+ S P+S P LS ++L Sbjct: 9 VSGTSAVRLSFSSSVSPPSSSPPLSRVSL 37 >At3g43670.1 68416.m04655 copper amine oxidase, putative similar to copper amine oxidase [Cicer arietinum] gi|3819099|emb|CAA08855 Length = 687 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = -3 Query: 199 YGLRPSSS-----NKCPLIGTKLTKWYASPVNLPVETPAFLSVFLRACG 68 +GL PSS N CP + ++ASP +P+ P + +F R G Sbjct: 339 FGLGPSSMPLVPLNDCPRNAYYIDGFFASPEGIPILQPNMICLFERYAG 387 >At5g35400.1 68418.m04207 tRNA pseudouridine synthase family protein weak similarity to SP|P07649 tRNA pseudouridine synthase A (EC 4.2.1.70) (Uracil hydrolyase) {Escherichia coli}; contains Pfam profile PF01416: tRNA pseudouridine synthase Length = 420 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 335 DRRLALTQKLGALEINQKRVKEAISKIGKHLRHLLGKGREY 457 D L + + ALE+ +K ++SK+ + L+HL GK Y Sbjct: 264 DDELEIEETSNALEVVEKPSDFSVSKVDQLLQHLQGKVLSY 304 >At4g36970.1 68417.m05239 remorin family protein contains Pfam domain, PF03763: Remorin, C-terminal region Length = 427 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +3 Query: 3 ENKGWAIGNTPELACAHNSHAIPQARKKTDKNAGVSTGRFTGEA 134 +NKGW+ P + +S AI R+ ++ ++T ++G A Sbjct: 24 DNKGWSSERVPHPSSTTSSSAINGGRRHIGSSSALTTPFYSGRA 67 >At2g10050.1 68415.m01043 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 120 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 69 PQARKKTDKNAGVSTGRFTGEAYHF 143 PQ +K K +G +T +FTG Y F Sbjct: 34 PQNTQKLKKKSGENTSKFTGTCYKF 58 >At1g05960.1 68414.m00625 expressed protein similar to hypothetical protein GB:AAF80120 GI:8810459 from [Arabidopsis thaliana ] Length = 982 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 141 FVSLVPINGHLFELDGLKP 197 F+SL +N H+F L+GL P Sbjct: 143 FISLQTVNSHMFNLEGLIP 161 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,493,474 Number of Sequences: 28952 Number of extensions: 366898 Number of successful extensions: 877 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 877 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1814318400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -