BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00174 (660 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12900.1 68416.m01607 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 2.7 >At3g12900.1 68416.m01607 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to SP|P10967 1-aminocyclopropane-1-carboxylate oxidase homolog (Protein E8) {Lycopersicon esculentum}, desacetoxyvindoline-4-hydroxylase [Catharanthus roseus] GI:2352812; contains Pfam profile PF03171: oxidoreductase, 2OG-Fe(II) oxygenase family Length = 357 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -1 Query: 150 FVRHS*TSVGGSANGFAN*VPNPFAQPLSLRMNV*RPFTCAQT 22 FV V G + + VP PF QPLS R+ + TC T Sbjct: 14 FVVREGNGVKGMIDSGLSSVPRPFVQPLSERIPTQKALTCEAT 56 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,744,403 Number of Sequences: 28952 Number of extensions: 242480 Number of successful extensions: 466 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 466 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -