BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00172 (783 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility pro... 25 2.6 AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility pro... 25 2.6 AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility pro... 25 2.6 AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility pro... 25 2.6 AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility pro... 25 2.6 AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility pro... 25 2.6 AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility pro... 25 2.6 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 25 3.5 >AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 1 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 38 >AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 1 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 38 >AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 3 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 40 >AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 3 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 40 >AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 49 LRYKQSGRLGRSRSAH--TEHVLLRPGDQ*RRRRGLHR 156 +++ + GR+ + + T+HVLL PG Q R R +H+ Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQFRTNRLVHK 41 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 24.6 bits (51), Expect = 3.5 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +3 Query: 366 KPLLIRITKFNSISLPTYI*CLNVYCDKCTYSNLFVY 476 K LLI T F ++LP+YI + +Y + ++N+ +Y Sbjct: 373 KMLLIVSTVFVCLNLPSYIVRVKIYLE-TEHTNMNIY 408 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,836 Number of Sequences: 2352 Number of extensions: 13130 Number of successful extensions: 73 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -