BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00172 (783 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57900.1 68418.m07243 SKP1/ASK1 interacting partner 1 (SKIP1)... 30 1.5 At1g27660.1 68414.m03381 ethylene-responsive protein -related co... 28 6.1 >At5g57900.1 68418.m07243 SKP1/ASK1 interacting partner 1 (SKIP1) / SCF (Skp1-cullin-F-box) ubiquitin ligase identical to SKP1 interacting partner 1 GI:10716947 from [Arabidopsis thaliana], PMID:11387208 Length = 300 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 5/49 (10%) Frame = -3 Query: 307 EWNER--GSMRISHRGAEPNDTDSNA---GEHHTNVLHVNNQFSKTSLR 176 +W+ R GS+ + A P D D+ A G+H N+ H+ QFS+ S++ Sbjct: 175 DWSSRHIGSVPTEYLDACPQDGDTEADAIGKHMINLEHLEIQFSRLSVK 223 >At1g27660.1 68414.m03381 ethylene-responsive protein -related contains similarity to ethylene-inducible ER33 protein [Lycopersicon esculentum] gi|5669656|gb|AAD46413 Length = 453 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/58 (22%), Positives = 26/58 (44%) Frame = +2 Query: 35 TDLQCCGINSPADWADHGLPIPSTCCSAQEINDGVVAACTENSTNFHSKGCLTKLVVH 208 +D C G +S W+ G+ + S S N+ + N+ N ++ C++ +H Sbjct: 29 SDPSCYGASSAHQWSPGGISLNSVSLSHNYNNEMLNTRAHNNNNNNNTSECMSLSSIH 86 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,329,435 Number of Sequences: 28952 Number of extensions: 264292 Number of successful extensions: 693 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1755792000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -