BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00168 (704 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 22 4.2 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 5.6 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 21 7.4 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 558 CFSGDSMRLNSAGL 517 CFSG+S L S GL Sbjct: 110 CFSGESTVLTSTGL 123 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.8 bits (44), Expect = 5.6 Identities = 10/37 (27%), Positives = 14/37 (37%) Frame = +3 Query: 318 CHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMTLNL 428 C+W PN T + D W S+ L+L Sbjct: 18 CNWSSGPNATLQSSACTDDLSSCWSEDMGSFSLPLDL 54 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 642 TRPSTLPSAKPV 607 T+PST P+ KPV Sbjct: 179 TKPSTKPTNKPV 190 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,270 Number of Sequences: 336 Number of extensions: 3539 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -