BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00168 (704 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80670.1 68414.m09466 transducin family protein / WD-40 repea... 81 5e-16 At1g15850.1 68414.m01902 transducin family protein / WD-40 repea... 81 5e-16 At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic c... 45 4e-05 At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic c... 44 1e-04 At1g29260.1 68414.m03578 peroxisomal targeting signal type 2 rec... 43 2e-04 At1g10580.1 68414.m01192 transducin family protein / WD-40 repea... 42 5e-04 At1g48630.1 68414.m05440 guanine nucleotide-binding family prote... 38 0.005 At3g18130.1 68416.m02305 guanine nucleotide-binding family prote... 38 0.006 At1g15440.2 68414.m01856 transducin family protein / WD-40 repea... 38 0.006 At1g15440.1 68414.m01855 transducin family protein / WD-40 repea... 38 0.006 At4g03020.1 68417.m00410 transducin family protein / WD-40 repea... 37 0.011 At4g15900.1 68417.m02416 PP1/PP2A phosphatases pleiotropic regul... 36 0.020 At3g16650.1 68416.m02128 PP1/PP2A phosphatases pleiotropic regul... 36 0.020 At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pf... 35 0.046 At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dep... 35 0.060 At5g15550.1 68418.m01820 transducin family protein / WD-40 repea... 34 0.080 At2g43770.1 68415.m05441 transducin family protein / WD-40 repea... 34 0.080 At1g69400.2 68414.m07968 transducin family protein / WD-40 repea... 34 0.080 At1g69400.1 68414.m07969 transducin family protein / WD-40 repea... 34 0.080 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 34 0.080 At5g15550.2 68418.m01821 transducin family protein / WD-40 repea... 34 0.11 At5g08390.1 68418.m00988 transducin family protein / WD-40 repea... 34 0.11 At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p... 33 0.14 At5g23430.2 68418.m02749 transducin family protein / WD-40 repea... 33 0.24 At5g23430.1 68418.m02748 transducin family protein / WD-40 repea... 33 0.24 At1g24530.1 68414.m03088 transducin family protein / WD-40 repea... 33 0.24 At4g18905.1 68417.m02787 transducin family protein / WD-40 repea... 31 0.56 At4g18900.1 68417.m02786 transducin family protein / WD-40 repea... 31 0.56 At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10... 31 0.56 At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10... 31 0.56 At3g27640.1 68416.m03452 transducin family protein / WD-40 repea... 31 0.74 At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ... 31 0.74 At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ... 31 0.74 At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ... 31 0.74 At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ... 31 0.74 At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ... 31 0.74 At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 ... 31 0.98 At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 ... 31 0.98 At5g63010.1 68418.m07905 WD-40 repeat family protein contains 4 ... 30 1.3 At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 pro... 30 1.3 At3g15980.3 68416.m02022 coatomer protein complex, subunit beta ... 30 1.3 At3g15980.2 68416.m02021 coatomer protein complex, subunit beta ... 30 1.3 At3g15980.1 68416.m02020 coatomer protein complex, subunit beta ... 30 1.3 At2g47990.1 68415.m06006 transducin family protein / WD-40 repea... 30 1.3 At1g52360.1 68414.m05909 coatomer protein complex, subunit beta ... 30 1.7 At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 p... 30 1.7 At5g10940.1 68418.m01269 transducin family protein / WD-40 repea... 29 2.3 At2g20330.1 68415.m02374 transducin family protein / WD-40 repea... 29 2.3 At1g72550.2 68414.m08390 tRNA synthetase beta subunit family pro... 29 2.3 At1g72550.1 68414.m08389 tRNA synthetase beta subunit family pro... 29 2.3 At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) co... 29 3.0 At2g43500.1 68415.m05405 RWP-RK domain-containing protein low si... 29 3.0 At3g15880.2 68416.m02009 WD-40 repeat family protein contains Pf... 29 4.0 At3g15880.1 68416.m02008 WD-40 repeat family protein contains Pf... 29 4.0 At5g64730.1 68418.m08140 transducin family protein / WD-40 repea... 28 5.2 At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5 ... 28 5.2 At4g11270.1 68417.m01823 transducin family protein / WD-40 repea... 28 5.2 At3g49660.1 68416.m05427 transducin family protein / WD-40 repea... 28 5.2 At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 pro... 28 6.9 At5g50120.1 68418.m06207 transducin family protein / WD-40 repea... 28 6.9 At3g18140.1 68416.m02306 transducin family protein / WD-40 repea... 28 6.9 At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10... 28 6.9 At3g15354.1 68416.m01939 WD-40 repeat family protein / phytochro... 28 6.9 At3g02110.1 68416.m00177 serine carboxypeptidase S10 family prot... 28 6.9 At2g40360.1 68415.m04977 transducin family protein / WD-40 repea... 28 6.9 At2g22040.1 68415.m02617 transducin family protein / WD-40 repea... 28 6.9 At1g19485.1 68414.m02427 AT hook motif-containing protein contai... 28 6.9 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 27 9.2 At4g38670.1 68417.m05475 pathogenesis-related thaumatin family p... 27 9.2 At3g21060.1 68416.m02662 transducin family protein / WD-40 repea... 27 9.2 At3g08840.3 68416.m01027 D-alanine--D-alanine ligase family simi... 27 9.2 At3g08840.2 68416.m01026 D-alanine--D-alanine ligase family simi... 27 9.2 >At1g80670.1 68414.m09466 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400) (1 weak); similar to Hypothetical RAE1-like protein.(SP:Q38942) [Arabidopsis thaliana]; similar to mRNA-associated protein mrnp 41 ((mRNA export protein) (GB:AAC28126) (GI:1903456)(RAE1) (MRNP41) (SP:P78406) [Homo sapiens] Length = 349 Score = 81.4 bits (192), Expect = 5e-16 Identities = 42/89 (47%), Positives = 53/89 (59%), Gaps = 3/89 (3%) Frame = +1 Query: 1 PNKDVEVSSPPDDTVSALEFSPPSVTLHTFLIAGSWDCQVRCWEVETSGKTV---PKAAQ 171 PNK EV+ P D++S+L FSP + L+A SWD QVRCWE+ SG ++ PKA+ Sbjct: 14 PNKSYEVTPSPADSISSLSFSPRA----DILVATSWDNQVRCWEISRSGASLASAPKASI 69 Query: 172 PMDGPVLDVAWHDDGTKVFMASTDKSVNV 258 D PVL AW DDGT VF DK + Sbjct: 70 SHDQPVLCSAWKDDGTTVFSGGCDKQAKM 98 Score = 78.6 bits (185), Expect = 4e-15 Identities = 38/95 (40%), Positives = 54/95 (56%), Gaps = 1/95 (1%) Frame = +3 Query: 225 FYGFNRQKCECWDL-AANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRT 401 F G ++ + W L + Q + VA H+ P+ WI P L T SWDKTLK+WDTR Sbjct: 88 FSGGCDKQAKMWPLLSGGQPVTVAMHEGPIAAMAWI--PGMNLLATGSWDKTLKYWDTRQ 145 Query: 402 AVPSMTLNLTERAYCADVEYPMAVVGTADRGICMY 506 P T L ++ Y V++P+ VVGTADR + ++ Sbjct: 146 QNPVHTQQLPDKCYTLSVKHPLMVVGTADRNLIVF 180 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/59 (52%), Positives = 43/59 (72%) Frame = +2 Query: 527 EFKRIESPLKHQHRCVSIFKDKKSKQPTGFALGSVEGRVAIQYVNPTNPKDNFTFKCHR 703 EFKRI+SPLK+Q RCV+ F D++ GF +GS+EGRV + +++ + NFTFKCHR Sbjct: 188 EFKRIQSPLKYQTRCVTAFPDQQ-----GFLVGSIEGRVGVHHLDDSQQSKNFTFKCHR 241 >At1g15850.1 68414.m01902 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); mRNA-associated protein mrnp 41 (SP:P78406) [Homo sapiens]; similar to mitotic checkpoint protein GI:9294423 from [Arabidopsis thaliana] Length = 140 Score = 81.4 bits (192), Expect = 5e-16 Identities = 39/89 (43%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +1 Query: 1 PNKDVEVSSPPDDTVSALEFSPPSVTLHTFLIAGSWDCQVRCWEVETSGKTV---PKAAQ 171 PN E++ P D++S+L FSP + L+A SWDCQVRCWE+ S ++ PK + Sbjct: 15 PNNSYEITPPATDSISSLSFSPKA----DILVATSWDCQVRCWEITRSDGSIASEPKVSM 70 Query: 172 PMDGPVLDVAWHDDGTKVFMASTDKSVNV 258 D PVL AW DDGT VF DK + Sbjct: 71 SHDQPVLCSAWKDDGTTVFTGGCDKQAKM 99 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/54 (42%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +3 Query: 225 FYGFNRQKCECWDLAAN-QTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLK 383 F G ++ + W L + Q VA HDAP WI P L+T SWDKTLK Sbjct: 89 FTGGCDKQAKMWPLLSGAQPSTVAMHDAPFNQIAWI--PGMNLLVTGSWDKTLK 140 >At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP|O43684)[Homo sapiens] Length = 340 Score = 45.2 bits (102), Expect = 4e-05 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 2/59 (3%) Frame = +2 Query: 533 KRIESPLKHQHRCVSIFKDKKSKQPTGFALGSVEGRVAIQY--VNPTNPKDNFTFKCHR 703 +R ES LK+Q RCV + + TG+AL SVEGRVA+++ ++ + FKCHR Sbjct: 179 QRRESSLKYQTRCVRCYPNG-----TGYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHR 232 Score = 42.7 bits (96), Expect = 2e-04 Identities = 27/71 (38%), Positives = 37/71 (52%) Frame = +1 Query: 1 PNKDVEVSSPPDDTVSALEFSPPSVTLHTFLIAGSWDCQVRCWEVETSGKTVPKAAQPMD 180 P+ E+S+PP D +S L FS S L+ SWD +VR ++V T+ K Sbjct: 6 PSAGRELSNPPSDGISNLRFSNNS----DHLLVSSWDKRVRLYDVSTNSL---KGEFLHG 58 Query: 181 GPVLDVAWHDD 213 G VLD +HDD Sbjct: 59 GAVLDCCFHDD 69 Score = 35.5 bits (78), Expect = 0.035 Identities = 27/78 (34%), Positives = 36/78 (46%), Gaps = 5/78 (6%) Frame = +3 Query: 288 VAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAV-PSMTLNLT----ERAYCAD 452 + HD V+ + A ++T SWDKT+K WD R A P T T ER Y Sbjct: 94 LGTHDKAVRCVEYSYAAGQ--VITGSWDKTVKCWDPRGASGPERTQVGTYLQPERVYSMS 151 Query: 453 VEYPMAVVGTADRGICMY 506 + VV TA R + +Y Sbjct: 152 LVGHRLVVATAGRHVNIY 169 >At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP:O43684)[Homo sapiens] Length = 339 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/59 (40%), Positives = 36/59 (61%), Gaps = 2/59 (3%) Frame = +2 Query: 533 KRIESPLKHQHRCVSIFKDKKSKQPTGFALGSVEGRVAIQY--VNPTNPKDNFTFKCHR 703 +R ES LK+Q RCV + + TG+AL SVEGRV++++ ++ + FKCHR Sbjct: 178 QRRESSLKYQTRCVRCYPNG-----TGYALSSVEGRVSMEFFDLSEAAQAKKYAFKCHR 231 Score = 36.7 bits (81), Expect = 0.015 Identities = 23/68 (33%), Positives = 34/68 (50%) Frame = +1 Query: 16 EVSSPPDDTVSALEFSPPSVTLHTFLIAGSWDCQVRCWEVETSGKTVPKAAQPMDGPVLD 195 E+S+PP D +S L FS S L+ SWD VR ++ + + + G VLD Sbjct: 10 ELSNPPSDGISNLRFSNNS----DHLLVSSWDKSVRLYD---ANGDLMRGEFKHGGAVLD 62 Query: 196 VAWHDDGT 219 +HDD + Sbjct: 63 CCFHDDSS 70 Score = 34.3 bits (75), Expect = 0.080 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +3 Query: 261 DLAANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTA 404 D A + + H+ PV+ + A ++T SWDKT+K WD R A Sbjct: 84 DFNAGKEDVLGTHEKPVRCVEYSYAAGQ--VITGSWDKTIKCWDPRGA 129 >At1g29260.1 68414.m03578 peroxisomal targeting signal type 2 receptor (PEX7) identical to peroxisomal targeting signal type 2 receptor (Pex7p) (GI:9502414) [Arabidopsis thaliana]; WD-40 repeat protein family member; contains 6 WD-40 repeats (PF00400); similar to peroxismal targeting signal 2 receptor (PTS2R) (Peroxin-7) (PEX7)(SP:O00628) [Homo sapiens] Length = 317 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +3 Query: 258 WDLAA-NQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRT-AVPSMTLN 425 WD+ TM + AHD + +C W K + L T+S DKT+K WD R+ VP LN Sbjct: 177 WDVREPGSTMIIPAHDFEILSCDWNKYDD-CILATSSVDKTVKVWDVRSYRVPLAVLN 233 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +1 Query: 97 AGSWDCQVRCWEVETSGKTVPKAAQPMDGPVLDVAWHD-DGTKVFMASTDKSVNV 258 + S DC +R W+V G T+ A D +L W+ D + +S DK+V V Sbjct: 167 SASGDCTLRIWDVREPGSTMIIPAH--DFEILSCDWNKYDDCILATSSVDKTVKV 219 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 354 MTTSWDKTLKFWDTRTAVPSMTLNLTERAYC 446 +T+SWD T+K W P+ E AYC Sbjct: 123 LTSSWDDTVKLWAMDR--PASVRTFKEHAYC 151 >At1g10580.1 68414.m01192 transducin family protein / WD-40 repeat family protein similar to splicing factor hPRP17 (gi|3283220); contains 7 WD-40 repeats (PF00400);similar to ESTs emb|F15435 and dbj|AUO62661 Length = 573 Score = 41.5 bits (93), Expect = 5e-04 Identities = 28/84 (33%), Positives = 41/84 (48%) Frame = +1 Query: 1 PNKDVEVSSPPDDTVSALEFSPPSVTLHTFLIAGSWDCQVRCWEVETSGKTVPKAAQPMD 180 P + V S VSA+ F P H L AG DC+V+ W+V SGK + + Sbjct: 271 PKRLVHTWSGHTKGVSAIRFFPKQG--HLLLSAGM-DCKVKIWDVYNSGKCM-RTYMGHA 326 Query: 181 GPVLDVAWHDDGTKVFMASTDKSV 252 V D+ + +DG+K A DK++ Sbjct: 327 KAVRDICFSNDGSKFLTAGYDKNI 350 >At1g48630.1 68414.m05440 guanine nucleotide-binding family protein / activated protein kinase C receptor, putative / RACK, putative contains 7 WD-40 repeats (PF00400); very similar to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; similar to WD-40 repeat auxin-dependent protein ARCA (SP:O24456) [Arabidopsis thaliana]; Length = 326 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +1 Query: 88 FLIAGSWDCQVRCWEVETSGKTVPKAAQPMDGPVLDVAWHDDGTKVFMASTDKSVNV 258 F ++GSWD ++R W++ T T D VL VA+ D ++ AS D+++ + Sbjct: 77 FALSGSWDGELRLWDLATGESTRRFVGHTKD--VLSVAFSTDNRQIVSASRDRTIKL 131 >At3g18130.1 68416.m02305 guanine nucleotide-binding family protein / activated protein kinase C receptor (RACK1) identical to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 326 Score = 37.9 bits (84), Expect = 0.006 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +1 Query: 88 FLIAGSWDCQVRCWEVETSGKTVPKAAQPMDGPVLDVAWHDDGTKVFMASTDKSVNV 258 F ++GSWD ++R W++ T T D VL VA+ D ++ AS D+++ + Sbjct: 77 FALSGSWDGELRLWDLATGETTRRFVGHTKD--VLSVAFSTDNRQIVSASRDRTIKL 131 >At1g15440.2 68414.m01856 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 860 Score = 37.9 bits (84), Expect = 0.006 Identities = 27/80 (33%), Positives = 38/80 (47%) Frame = +1 Query: 16 EVSSPPDDTVSALEFSPPSVTLHTFLIAGSWDCQVRCWEVETSGKTVPKAAQPMDGPVLD 195 ++ S + V L FSP L L + SWD VR W+V S TV D VL Sbjct: 471 DILSGHEAPVHGLMFSP----LTQLLASSSWDYTVRLWDVFASKGTVETFRHNHD--VLT 524 Query: 196 VAWHDDGTKVFMASTDKSVN 255 VA+ DG ++ ++ D +N Sbjct: 525 VAFRPDGKQLASSTLDGQIN 544 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +3 Query: 258 WDLAANQTMQV-AAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWD 392 W Q + + H+APV + +P L ++SWD T++ WD Sbjct: 462 WSKKTGQIKDILSGHEAPVHGLMF--SPLTQLLASSSWDYTVRLWD 505 >At1g15440.1 68414.m01855 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 900 Score = 37.9 bits (84), Expect = 0.006 Identities = 27/80 (33%), Positives = 38/80 (47%) Frame = +1 Query: 16 EVSSPPDDTVSALEFSPPSVTLHTFLIAGSWDCQVRCWEVETSGKTVPKAAQPMDGPVLD 195 ++ S + V L FSP L L + SWD VR W+V S TV D VL Sbjct: 511 DILSGHEAPVHGLMFSP----LTQLLASSSWDYTVRLWDVFASKGTVETFRHNHD--VLT 564 Query: 196 VAWHDDGTKVFMASTDKSVN 255 VA+ DG ++ ++ D +N Sbjct: 565 VAFRPDGKQLASSTLDGQIN 584 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +3 Query: 258 WDLAANQTMQV-AAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWD 392 W Q + + H+APV + +P L ++SWD T++ WD Sbjct: 502 WSKKTGQIKDILSGHEAPVHGLMF--SPLTQLLASSSWDYTVRLWD 545 >At4g03020.1 68417.m00410 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to L. erythrorhizon LEC14B, GenBank accession number Q40153 Length = 493 Score = 37.1 bits (82), Expect = 0.011 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 225 FYGFNRQKCECWDLAANQTMQVAAH-DAPVKTCHWIKAPNYTCLMTTSWDKTLKFWD 392 + G N +DL + + V H +PV+ C+W P Y L+++SWD L W+ Sbjct: 417 YTGSNDSSVYIYDLVSGDKVAVLKHHSSPVRDCNW--HPYYPTLISSSWDGDLVKWE 471 >At4g15900.1 68417.m02416 PP1/PP2A phosphatases pleiotropic regulator 1 (PRL1) identical to PP1/PP2A phosphatases pleiotropic regulator PRL1 (SP:Q42384) [Arabidopsis thaliana], PRL1 [Arabidopsis thaliana] GI:577733; contains Pfam PF00400: WD domain, G-beta repeat (7 copies) Length = 486 Score = 36.3 bits (80), Expect = 0.020 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 1/73 (1%) Frame = +3 Query: 249 CECWDLAAN-QTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMTLN 425 C WD+ Q ++ HD V C P ++T S D T+KFWD R TL Sbjct: 284 CRVWDIRTKMQIFALSGHDNTV--CSVFTRPTDPQVVTGSHDTTIKFWDLRYGKTMSTLT 341 Query: 426 LTERAYCADVEYP 464 +++ A +P Sbjct: 342 HHKKSVRAMTLHP 354 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 336 PNYTCLMTTSWDKTLKFWDTRTAVPSMTL 422 P+ T S D+T+K WD T V +TL Sbjct: 186 PSNEWFCTGSADRTIKIWDVATGVLKLTL 214 >At3g16650.1 68416.m02128 PP1/PP2A phosphatases pleiotropic regulator 2 (PRL2) identical to SP|Q39190 PP1/PP2A phosphatases pleiotropic regulator PRL2 {Arabidopsis thaliana}, GB:Q39190 from [Arabidopsis thaliana]; contains Pfam PF00400: WD domain, G-beta repeat (7 copies, 1 weak) Length = 479 Score = 36.3 bits (80), Expect = 0.020 Identities = 20/72 (27%), Positives = 32/72 (44%) Frame = +3 Query: 249 CECWDLAANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMTLNL 428 C WD+ + V HD+ V + + P ++T S D T+KFWD R T+ Sbjct: 278 CRVWDIRTKMQIFVLPHDSDVFSV--LARPTDPQVITGSHDSTIKFWDLRYGKSMATITN 335 Query: 429 TERAYCADVEYP 464 ++ A +P Sbjct: 336 HKKTVRAMALHP 347 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 336 PNYTCLMTTSWDKTLKFWDTRTAVPSMTL 422 P+ T S D+T+K WD T V +TL Sbjct: 180 PSNEWFCTGSADRTIKIWDVATGVLKLTL 208 >At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pfam profile PF00400: WD domain, G-beta repeat Length = 580 Score = 35.1 bits (77), Expect = 0.046 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +3 Query: 231 GFNRQKCECWDLAANQTMQV-AAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTR 398 GF+ +C +DL N + AHD V + AP L+++S DKTL+ WD R Sbjct: 430 GFSSGQCRLFDLRENGFISSWRAHDGYVTK---LVAPESHLLVSSSLDKTLRIWDLR 483 >At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dependent protein (ARCA) / guanine nucleotide-binding protein beta subunit, putative identical to SP|O24456 Guanine nucleotide-binding protein beta subunit-like protein (WD-40 repeat auxin-dependent protein ARCA) {Arabidopsis thaliana}; contains 7 WD-40 repeats (PF00400) Length = 327 Score = 34.7 bits (76), Expect = 0.060 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = +1 Query: 88 FLIAGSWDCQVRCWEVETSGKTVPKAAQPMDGPVLDVAWHDDGTKVFMASTDKSVNV 258 F ++GSWD ++R W++ T D VL VA+ D ++ AS D+++ + Sbjct: 77 FALSGSWDGELRLWDLAAGVSTRRFVGHTKD--VLSVAFSLDNRQIVSASRDRTIKL 131 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 37 DTVSALEFSPPSVTLHTFLIAGSWDCQVRCWEV 135 D VS + FSP TL +++ SWD V+ W + Sbjct: 151 DWVSCVRFSPN--TLQPTIVSASWDKTVKVWNL 181 >At5g15550.1 68418.m01820 transducin family protein / WD-40 repeat family protein similar to YTM1 - Homo sapiens, EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta repeat (7 copies,1 weak); Length = 433 Score = 34.3 bits (75), Expect = 0.080 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 2/73 (2%) Frame = +3 Query: 285 QVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMTLNL-TERAYCADVEY 461 Q ++H + + C W K+ ++ L++ S+D + WD RTA P ++ ++ AD Sbjct: 353 QFSSHSSWISACKWHKS-SWFHLLSASYDGKIMLWDLRTAWPLSVIDTHNDKVLSADWWK 411 Query: 462 PMAVV-GTADRGI 497 +VV G AD + Sbjct: 412 GESVVSGGADSNL 424 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 288 VAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMTL 422 + H V + W P + + ++SWD +++ WD T S+ L Sbjct: 268 LVGHTQCVSSVVW---PEHDVIYSSSWDHSVRRWDVETGKDSLNL 309 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 82 HTFLIAGSWDCQVRCWEVET 141 H + + SWD VR W+VET Sbjct: 283 HDVIYSSSWDHSVRRWDVET 302 >At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to U5 snRNP-specific 40 kDa protein (GI:3820594) [Homo sapiens] Length = 343 Score = 34.3 bits (75), Expect = 0.080 Identities = 20/70 (28%), Positives = 34/70 (48%) Frame = +1 Query: 43 VSALEFSPPSVTLHTFLIAGSWDCQVRCWEVETSGKTVPKAAQPMDGPVLDVAWHDDGTK 222 V ++F+P T + +GS D ++ W V K + +LD+ W DG++ Sbjct: 56 VYTMKFNPAG----TLIASGSHDREIFLWRVHGDCKNF-MVLKGHKNAILDLHWTSDGSQ 110 Query: 223 VFMASTDKSV 252 + AS DK+V Sbjct: 111 IVSASPDKTV 120 Score = 27.9 bits (59), Expect = 6.9 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 10/53 (18%) Frame = +1 Query: 91 LIAGSWDCQVRCWEVETSGKTVPKAAQPMD----------GPVLDVAWHDDGT 219 +++ S D VR W+VET GK + K A+ GP L ++ DDGT Sbjct: 111 IVSASPDKTVRAWDVET-GKQIKKMAEHSSFVNSCCPTRRGPPLIISGSDDGT 162 >At1g69400.2 68414.m07968 transducin family protein / WD-40 repeat family protein similar to mitotic checkpoint protein (GI:9294423) {Arabidopsis thaliana}; similar to mitotic checkpoint protein (BUB3) (SP:O43684) (Homo sapiens) Length = 272 Score = 34.3 bits (75), Expect = 0.080 Identities = 13/31 (41%), Positives = 24/31 (77%), Gaps = 1/31 (3%) Frame = +2 Query: 611 GFALGSVEGRVAIQYVNPT-NPKDNFTFKCH 700 G+A+GSV+GRVA+ + N + + + ++F+CH Sbjct: 191 GYAVGSVDGRVAVDFPNTSCSSEIKYSFRCH 221 >At1g69400.1 68414.m07969 transducin family protein / WD-40 repeat family protein similar to mitotic checkpoint protein (GI:9294423) {Arabidopsis thaliana}; similar to mitotic checkpoint protein (BUB3) (SP:O43684) (Homo sapiens) Length = 314 Score = 34.3 bits (75), Expect = 0.080 Identities = 13/31 (41%), Positives = 24/31 (77%), Gaps = 1/31 (3%) Frame = +2 Query: 611 GFALGSVEGRVAIQYVNPT-NPKDNFTFKCH 700 G+A+GSV+GRVA+ + N + + + ++F+CH Sbjct: 191 GYAVGSVDGRVAVDFPNTSCSSEIKYSFRCH 221 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 34.3 bits (75), Expect = 0.080 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 258 WDLAANQTM-QVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRT 401 WDL A + + + H+ P+++ + P L T S D+T+KFWD T Sbjct: 118 WDLTAGKLLHEFKCHEGPIRSLDF--HPLEFLLATGSADRTVKFWDLET 164 >At5g15550.2 68418.m01821 transducin family protein / WD-40 repeat family protein similar to YTM1 - Homo sapiens, EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta repeat (7 copies,1 weak); Length = 402 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +3 Query: 285 QVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAV 407 Q ++H + + C W K+ ++ L++ S+D + WD RTAV Sbjct: 353 QFSSHSSWISACKWHKS-SWFHLLSASYDGKIMLWDLRTAV 392 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 288 VAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMTL 422 + H V + W P + + ++SWD +++ WD T S+ L Sbjct: 268 LVGHTQCVSSVVW---PEHDVIYSSSWDHSVRRWDVETGKDSLNL 309 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 82 HTFLIAGSWDCQVRCWEVET 141 H + + SWD VR W+VET Sbjct: 283 HDVIYSSSWDHSVRRWDVET 302 >At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat family protein similar to katanin p80 subunit [Strongylocentrotus purpuratus] GI:3005601; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 871 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +3 Query: 258 WDLAANQTM-QVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRT 401 WDL A + + + +H+ +++ + P+ L T S DKT+KFWD T Sbjct: 263 WDLTAGKLLHEFKSHEGKIQSLDF--HPHEFLLATGSADKTVKFWDLET 309 >At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p80 subunit, putative contains 5 WD-40 repeats (PF00400); similar to katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 1180 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 258 WDLAANQTM-QVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRT 401 WDL A + + + H+ P+++ + P L T S D+T+KFWD T Sbjct: 169 WDLTAGKLLHEFKFHEGPIRSLDF--HPLEFLLATGSADRTVKFWDLET 215 >At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 836 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +3 Query: 258 WDLAANQTM-QVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRT 401 WDL A + + + +H+ +++ + P+ L T S D+T+KFWD T Sbjct: 170 WDLTAGKLLTEFKSHEGQIQSLDF--HPHEFLLATGSADRTVKFWDLET 216 >At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 837 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +3 Query: 258 WDLAANQTM-QVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRT 401 WDL A + + + +H+ +++ + P+ L T S D+T+KFWD T Sbjct: 170 WDLTAGKLLTEFKSHEGQIQSLDF--HPHEFLLATGSADRTVKFWDLET 216 >At1g24530.1 68414.m03088 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina}; contains 7 WD-40 repeats (PF00400) Length = 418 Score = 32.7 bits (71), Expect = 0.24 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 2/77 (2%) Frame = +1 Query: 34 DDTVSALEFSPPSVTLHTFLIAGSWDCQVRCWEVETSGK--TVPKAAQPMDGPVLDVAWH 207 DD V+A+ S T++T GS D ++R W T K T+ + V +A + Sbjct: 235 DDAVNAIAVSTNG-TVYT----GSADRRIRVWAKPTGEKRHTLVATLEKHKSAVNALALN 289 Query: 208 DDGTKVFMASTDKSVNV 258 DDG+ +F S D+S+ V Sbjct: 290 DDGSVLFSGSCDRSILV 306 >At4g18905.1 68417.m02787 transducin family protein / WD-40 repeat family protein contains 5 (4 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 494 Score = 31.5 bits (68), Expect = 0.56 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +3 Query: 261 DLAANQTMQVAAHDAPVKTCHW-IKAPNYTCLMTTSWDKTLKFWDTRTAVPS 413 DL T+Q A D V + + I PN L T S DK++K WD PS Sbjct: 391 DLNPTYTIQAHAQDRGVSSISYNISTPNL--LATGSMDKSVKLWDLSNNEPS 440 >At4g18900.1 68417.m02786 transducin family protein / WD-40 repeat family protein contains 5 (4 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 461 Score = 31.5 bits (68), Expect = 0.56 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +3 Query: 231 GFNRQKCECWDLAANQTMQVAAHD-APVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAV 407 GF+ ++ +N + + HD A + I APN L T S D+T+K WD Sbjct: 346 GFDVRQASISASESNPSFTINGHDEAATSVSYNISAPNL--LATGSKDRTVKLWDLSNNE 403 Query: 408 PS 413 PS Sbjct: 404 PS 405 >At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 31.5 bits (68), Expect = 0.56 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +3 Query: 276 QTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMT 419 Q +++ AH V + C++T DKT+K WD T V T Sbjct: 454 QHLEIDAHVGGVNDISFSTPNKQLCVITCGDDKTIKVWDAATGVKRHT 501 >At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 31.5 bits (68), Expect = 0.56 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +3 Query: 276 QTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMT 419 Q +++ AH V + C++T DKT+K WD T V T Sbjct: 454 QHLEIDAHVGGVNDISFSTPNKQLCVITCGDDKTIKVWDAATGVKRHT 501 >At3g27640.1 68416.m03452 transducin family protein / WD-40 repeat family protein contains seven WD-40 G-protein beta repeats; similar to RA-regulated nuclear matrix-associated protein (GI:14161320) {Homo sapiens} Length = 535 Score = 31.1 bits (67), Expect = 0.74 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 294 AHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWD 392 AH + WIK + CL+T S D+T+K WD Sbjct: 126 AHYNAIFDISWIKGDS--CLLTASGDQTIKVWD 156 >At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 785 Score = 31.1 bits (67), Expect = 0.74 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 336 PNYTCLMTTSWDKTLKFWD 392 PN T L T+S+DKT+K WD Sbjct: 560 PNSTQLATSSFDKTIKIWD 578 Score = 31.1 bits (67), Expect = 0.74 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 243 QKCECWDLAANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFW 389 Q E W+ N+ M VA H+ + ++P+ + + S DK++K W Sbjct: 738 QAIELWNTMENKCMTVAGHECVISAL--AQSPSTGVVASASHDKSVKIW 784 >At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 31.1 bits (67), Expect = 0.74 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 336 PNYTCLMTTSWDKTLKFWD 392 PN T L T+S+DKT+K WD Sbjct: 562 PNSTQLATSSFDKTIKIWD 580 Score = 31.1 bits (67), Expect = 0.74 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 243 QKCECWDLAANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFW 389 Q E W+ N+ M VA H+ + ++P+ + + S DK++K W Sbjct: 740 QAIELWNTMENKCMTVAGHECVISAL--AQSPSTGVVASASHDKSVKIW 786 >At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 31.1 bits (67), Expect = 0.74 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 336 PNYTCLMTTSWDKTLKFWD 392 PN T L T+S+DKT+K WD Sbjct: 562 PNSTQLATSSFDKTIKIWD 580 Score = 31.1 bits (67), Expect = 0.74 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 243 QKCECWDLAANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFW 389 Q E W+ N+ M VA H+ + ++P+ + + S DK++K W Sbjct: 740 QAIELWNTMENKCMTVAGHECVISAL--AQSPSTGVVASASHDKSVKIW 786 >At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 31.1 bits (67), Expect = 0.74 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 336 PNYTCLMTTSWDKTLKFWD 392 PN T L T+S+DKT+K WD Sbjct: 562 PNSTQLATSSFDKTIKIWD 580 Score = 31.1 bits (67), Expect = 0.74 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 243 QKCECWDLAANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFW 389 Q E W+ N+ M VA H+ + ++P+ + + S DK++K W Sbjct: 740 QAIELWNTMENKCMTVAGHECVISAL--AQSPSTGVVASASHDKSVKIW 786 >At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 31.1 bits (67), Expect = 0.74 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 336 PNYTCLMTTSWDKTLKFWD 392 PN T L T+S+DKT+K WD Sbjct: 562 PNSTQLATSSFDKTIKIWD 580 Score = 31.1 bits (67), Expect = 0.74 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 243 QKCECWDLAANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFW 389 Q E W+ N+ M VA H+ + ++P+ + + S DK++K W Sbjct: 740 QAIELWNTMENKCMTVAGHECVISAL--AQSPSTGVVASASHDKSVKIW 786 >At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 30.7 bits (66), Expect = 0.98 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +3 Query: 276 QTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMT 419 Q +++ AH V + C+ T DKT+K WD T V T Sbjct: 454 QHLEIDAHVGGVNDIAFSTPNKQLCVTTCGDDKTIKVWDAATGVKRYT 501 >At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 30.7 bits (66), Expect = 0.98 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +3 Query: 276 QTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMT 419 Q +++ AH V + C+ T DKT+K WD T V T Sbjct: 454 QHLEIDAHVGGVNDIAFSTPNKQLCVTTCGDDKTIKVWDAATGVKRYT 501 >At5g63010.1 68418.m07905 WD-40 repeat family protein contains 4 WD-40 repeats (PF00400);low similarity to photomorphogenesis repressor (COP1) GI:2702280 [Arabidopsis thaliana] and COP1 GI:11127996 [Ipomoea nil] Length = 343 Score = 30.3 bits (65), Expect = 1.3 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 4/73 (5%) Frame = +3 Query: 225 FYGFNRQKCECWDL----AANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWD 392 + G + K CWD+ A N+ Q + C + + T S+D+TL+ WD Sbjct: 180 YTGSDDCKFSCWDIRDSPADNRVFQNSKVHTMGVCCISSNPSDPYSIFTGSYDETLRVWD 239 Query: 393 TRTAVPSMTLNLT 431 TR+ S LN T Sbjct: 240 TRSV--SRPLNET 250 >At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 protein (ZFWD1) identical to zfwd1 protein (GI:12057164) [Arabidopsis thaliana] Length = 430 Score = 30.3 bits (65), Expect = 1.3 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 1/85 (1%) Frame = +3 Query: 228 YGFNRQKCECWDLAANQTMQVAAHDAPVKTCHWIKAPNYTC-LMTTSWDKTLKFWDTRTA 404 YG + CW + ++ + D K I P+ + L T S D+T++ WD + Sbjct: 118 YGDKCRYLHCWSKGDSFSL-LTQLDGHQKVVTGIALPSGSDKLYTASKDETVRIWDCASG 176 Query: 405 VPSMTLNLTERAYCADVEYPMAVVG 479 + LNL C E P +VG Sbjct: 177 QCTGVLNLGGEVGCIISEGPWLLVG 201 >At3g15980.3 68416.m02022 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 30.3 bits (65), Expect = 1.3 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 4/81 (4%) Frame = +3 Query: 258 WDLAA-NQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMTLN--- 425 W+L + + + AH V + + L+T S D T K WD +T TL+ Sbjct: 170 WNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLDGHT 229 Query: 426 LTERAYCADVEYPMAVVGTAD 488 A C E P+ + G+ D Sbjct: 230 HNVSAVCFHPELPIIITGSED 250 >At3g15980.2 68416.m02021 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 30.3 bits (65), Expect = 1.3 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 4/81 (4%) Frame = +3 Query: 258 WDLAA-NQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMTLN--- 425 W+L + + + AH V + + L+T S D T K WD +T TL+ Sbjct: 170 WNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLDGHT 229 Query: 426 LTERAYCADVEYPMAVVGTAD 488 A C E P+ + G+ D Sbjct: 230 HNVSAVCFHPELPIIITGSED 250 >At3g15980.1 68416.m02020 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 909 Score = 30.3 bits (65), Expect = 1.3 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 4/81 (4%) Frame = +3 Query: 258 WDLAA-NQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMTLN--- 425 W+L + + + AH V + + L+T S D T K WD +T TL+ Sbjct: 170 WNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLDGHT 229 Query: 426 LTERAYCADVEYPMAVVGTAD 488 A C E P+ + G+ D Sbjct: 230 HNVSAVCFHPELPIIITGSED 250 >At2g47990.1 68415.m06006 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina}; contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GP:17225206)[Podospora anserina] Length = 530 Score = 30.3 bits (65), Expect = 1.3 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Frame = +3 Query: 258 WDLA-ANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMTLNLTE 434 WD+A A + H V+ C N + L+T S+D T+K WD R + + Sbjct: 163 WDVAGATVISDLLGHKDYVR-CGDCSPVNDSMLVTGSYDHTVKVWDARVHTSNWIAEINH 221 Query: 435 RAYCADVEY 461 DV Y Sbjct: 222 GLPVEDVVY 230 >At1g52360.1 68414.m05909 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to (SP:O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus]; similar to GI:298096 from [Homo sapiens] Length = 926 Score = 29.9 bits (64), Expect = 1.7 Identities = 22/81 (27%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = +3 Query: 258 WDLAA-NQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRTAVPSMTL---N 425 W+L + + + AH V + + L+T S D T K WD +T TL Sbjct: 170 WNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHT 229 Query: 426 LTERAYCADVEYPMAVVGTAD 488 A C E P+ + G+ D Sbjct: 230 HNVSAVCFHPELPIIITGSED 250 >At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 1187 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +1 Query: 88 FLIAGSWDCQVRCWEVETSGKTVPKAAQPMDGPVLDVAWHDDGTKVFMASTDKSVNV 258 F I+GS DC V+ W+ G + + G V ++ D K+ S D SV V Sbjct: 869 FFISGSTDCLVKIWDPSLRGSELRATLKGHTGTVRAIS--SDRGKIVSGSDDLSVIV 923 >At5g10940.1 68418.m01269 transducin family protein / WD-40 repeat family protein unnamed ORF cDNA FLJ10872, Homo sapiens, EMBL:AK001734; contains Pfam PF00400: WD domain, G-beta repeat (6 copies,1 weak) Length = 757 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 258 WDLAANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSW-DKTLKFWDTRTAVPSM 416 W+ + M+V D V C I+ + ++ TS D T+K W +VPS+ Sbjct: 648 WEKQTGRLMKVLVGDESVLNC--IQCHPFDSVVATSGIDNTIKIWSPTASVPSI 699 >At2g20330.1 68415.m02374 transducin family protein / WD-40 repeat family protein similar to Transcriptional repressor rco-1 (SP:P78706) [Neurospora crassa]; similar to TUP1(GB:AF079369); contains 6 WD-40 repeats (PF00400) Length = 648 Score = 29.5 bits (63), Expect = 2.3 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Frame = +1 Query: 91 LIAGSWDCQVRCWEVET--SGKTV--PKAAQPMDGPVLDVAWHDDGTKVFMASTDKSVNV 258 ++ S D +R W+V S V PK A+P PV AW DG ++ D S+ + Sbjct: 294 VLTSSEDGSLRIWDVNNFLSQTQVIKPKLARPGRVPVTTCAWDRDGKRIAGGVGDGSIQI 353 >At1g72550.2 68414.m08390 tRNA synthetase beta subunit family protein contains Pfam profiles: PF03484 phenylalanine-tRNA synthetase, B5 domain, PF03483 B3/4 domain; an isoform contains a non-consensus TG acceptor splice site at a terminal exon. Length = 584 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -1 Query: 263 VPTFTLLSVEAIKTFVPSSCQATSRTGPSIGCAAL-GTVFPEVSTSQHLTWQSQLPAIRK 87 +PT+TL + K + TS+ P + CA L G F E + + Q +L + Sbjct: 93 IPTYTLADISKDKILQMNVKPETSKIRPFVVCAVLRGVTFDEARYNSFIDLQDKLH--QN 150 Query: 86 VCR 78 +CR Sbjct: 151 ICR 153 >At1g72550.1 68414.m08389 tRNA synthetase beta subunit family protein contains Pfam profiles: PF03484 phenylalanine-tRNA synthetase, B5 domain, PF03483 B3/4 domain; an isoform contains a non-consensus TG acceptor splice site at a terminal exon. Length = 598 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -1 Query: 263 VPTFTLLSVEAIKTFVPSSCQATSRTGPSIGCAAL-GTVFPEVSTSQHLTWQSQLPAIRK 87 +PT+TL + K + TS+ P + CA L G F E + + Q +L + Sbjct: 93 IPTYTLADISKDKILQMNVKPETSKIRPFVVCAVLRGVTFDEARYNSFIDLQDKLH--QN 150 Query: 86 VCR 78 +CR Sbjct: 151 ICR 153 >At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) contains seven G-protein beta WD-40 repeats; beta transducin-like protein, Podospora anserina, gb:L28125; contains Pfam profiles PF04503: Single-stranded DNA binding protein, SSDP; PF00400:WD domain, G-beta repeat; identical to cDNA LEUNIG (LEUNIG) GI:11141604 Length = 931 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 243 QKCECWDLAANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFW 389 Q E W+++ N+TM + AH+ + + A + + S DK +K W Sbjct: 884 QSLELWNMSENKTMTLPAHEGLITSLAVSTATG--LVASASHDKLVKLW 930 >At2g43500.1 68415.m05405 RWP-RK domain-containing protein low similarity to nodule inception protein [Lotus japonicus] GI:6448579; contains Pfam profile: PF02042 RWP-RK domain Length = 947 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +2 Query: 260 GLSSQPNDAGSGARRSSEDLPLDQSAQL 343 GLSS NDA ARRS ED+P D S +L Sbjct: 696 GLSSLDNDAH--ARRSQEDMPDDTSFKL 721 >At3g15880.2 68416.m02009 WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 1135 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 282 MQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRT 401 +++ AH V + + C++T DKT+K WD T Sbjct: 458 LEIDAHAGNVNDLAFSQPNQQLCVVTCGEDKTIKVWDAVT 497 Score = 27.5 bits (58), Expect = 9.2 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 6/71 (8%) Frame = +3 Query: 258 WD-LAANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFW-----DTRTAVPSMT 419 WD + N+ H+APV + + N + +T+ D +K W +R + Sbjct: 493 WDAVTGNKLHTFEGHEAPVYSVCPHQKENIQFIFSTAVDGKIKAWLYDNMGSRVDYDAPG 552 Query: 420 LNLTERAYCAD 452 + T AYCAD Sbjct: 553 RSCTSMAYCAD 563 >At3g15880.1 68416.m02008 WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 1137 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 282 MQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWDTRT 401 +++ AH V + + C++T DKT+K WD T Sbjct: 458 LEIDAHAGNVNDLAFSQPNQQLCVVTCGEDKTIKVWDAVT 497 Score = 27.5 bits (58), Expect = 9.2 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 6/71 (8%) Frame = +3 Query: 258 WD-LAANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFW-----DTRTAVPSMT 419 WD + N+ H+APV + + N + +T+ D +K W +R + Sbjct: 493 WDAVTGNKLHTFEGHEAPVYSVCPHQKENIQFIFSTAVDGKIKAWLYDNMGSRVDYDAPG 552 Query: 420 LNLTERAYCAD 452 + T AYCAD Sbjct: 553 RSCTSMAYCAD 563 >At5g64730.1 68418.m08140 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8) [Fruit fly] {Drosophila m.] Length = 299 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 258 WDLA-ANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFW 389 WDL A + AHD V + + P C++T+S D T++ W Sbjct: 255 WDLVDAKVLSKFRAHDLVVTSVSY--HPKEDCMLTSSVDGTIRVW 297 >At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to pre-mRNA splicing factor PRP17 (SP:O60508) [Homo sapiens] Length = 457 Score = 28.3 bits (60), Expect = 5.2 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +1 Query: 43 VSALEFSPPSVTLHTFLIAGSW-DCQVRCWEVETSGKTVPKAAQPMDGPVLDVAWHDDGT 219 V+A+++S T H L+A + D V W V ++ K +A + PV DV W G Sbjct: 163 VTAIDWS----TSHVHLLASAGLDGAVYVWNVWSNDKKKVRAFLHHNAPVKDVKWSKQGL 218 Query: 220 KVFMASTD 243 + D Sbjct: 219 SLLSCGYD 226 >At4g11270.1 68417.m01823 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to TGF-beta resistance-associated protein TRAG (GI:15624071) {Mus musculus}; similar to beta-transducin repeats containing protein - Homo sapiens,PID:e1284220; 3' EST no_NP:TC8031 Length = 1446 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 91 LIAGSWDCQVRCWEVETSGKTV 156 LI+GS DC +R W++E SG + Sbjct: 552 LISGSMDCTIRIWDLE-SGNVI 572 >At3g49660.1 68416.m05427 transducin family protein / WD-40 repeat family protein beta-transducin, Schizosaccharomyces pombe, EMBL:CAA17803 Length = 317 Score = 28.3 bits (60), Expect = 5.2 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +3 Query: 351 LMTTSWDKTLKFWDTRTAVPSMTL-NLTERAYCADV--EYPMAVVGTADRGI 497 +++ S DKTLK WD T TL T A+C + + M V G+ D + Sbjct: 86 IVSASDDKTLKLWDVETGSLIKTLIGHTNYAFCVNFNPQSNMIVSGSFDETV 137 >At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 protein (ZFWD2), putative 99.8% identical to zfwd2 protein (GI:12057166) [Arabidopsis thaliana]; contains 6 copies (2 weak) Pfam PF00400: WD domain, G-beta repeat; contains Pfam PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) domain Length = 437 Score = 27.9 bits (59), Expect = 6.9 Identities = 25/92 (27%), Positives = 37/92 (40%), Gaps = 3/92 (3%) Frame = +3 Query: 213 WDEG--FYGFNRQKCECWDLAANQTMQVAAHDAPVKTCHWIKAPNYTC-LMTTSWDKTLK 383 W +G YG + CW + + + D K I P+ + L T S D+TL+ Sbjct: 118 WVDGNCTYGDKCRYLHCWSKGESFAL-LTQLDGHEKLVSGIALPSGSDKLYTGSKDETLR 176 Query: 384 FWDTRTAVPSMTLNLTERAYCADVEYPMAVVG 479 WD + + L L C E P +VG Sbjct: 177 VWDCASGQCTGVLKLGGEIGCVLSEGPWLLVG 208 >At5g50120.1 68418.m06207 transducin family protein / WD-40 repeat family protein Similar to En/Spm-like transposon protein (gi:2739374)[Arabidopsis thaliana]; similar to GTP-binding regulatory protein and WD-repeat protein; contains 7 WD-40 repeats Length = 388 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 345 TCLMTTSWDKTLKFWDT 395 T L + SWD+TLK W T Sbjct: 178 TLLYSVSWDRTLKIWRT 194 >At3g18140.1 68416.m02306 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Pop3 (GP:3434986) [Schizosaccharomyces pombe] Length = 305 Score = 27.9 bits (59), Expect = 6.9 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 8/60 (13%) Frame = +3 Query: 237 NRQKCECWDLA-ANQTM-------QVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWD 392 NR C W L QTM ++ AH+ + C A Y L T S DKT+K W+ Sbjct: 182 NRGTCYVWRLLRGKQTMTEFEPLHKLQAHNGHILKCLLSPANKY--LATASSDKTVKIWN 239 >At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +3 Query: 258 WDLAANQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFW 389 WDL+ + H+APV + + N + +T+ D +K W Sbjct: 482 WDLSGKKLFTFEGHEAPVYSICPHQKENIQFIFSTALDGKIKAW 525 >At3g15354.1 68416.m01939 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400); phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana] Length = 837 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 312 KTCHWIKAPNYTCLMTTSWDKTLKFWD 392 KT ++K + + L+++S D TLK WD Sbjct: 705 KTVSYVKFVDSSTLVSSSTDNTLKLWD 731 >At3g02110.1 68416.m00177 serine carboxypeptidase S10 family protein similar to serine carboxypeptidase II (CP-MII) GB:CAA70815 (SP:P08818) [Hordeum vulgare] Length = 473 Score = 27.9 bits (59), Expect = 6.9 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = -2 Query: 580 DGDAAVLVLQRRLDALELGGLALQVYMQMPRSAVPTTAIGYSTSAQYALSVRL 422 D D+ VL + R + A GG+ + V+ S VP TA YS A+ +LS +L Sbjct: 368 DTDSTVLPIYREMIA---GGIRVWVFSGDVDSVVPVTATRYSL-ARLSLSTKL 416 >At2g40360.1 68415.m04977 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to block of proliferation protein Bop1 (GI:1679772) [Mus musculus] Length = 753 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 88 FLIAGSWDCQVRCWEVETSGKTVPKAAQPMDGPVLDVAWH 207 ++ +GS D VR WEVET G+ + K Q D ++ VAW+ Sbjct: 437 WIASGSTDGSVRMWEVET-GRCL-KVWQ-FDEAIMCVAWN 473 >At2g22040.1 68415.m02617 transducin family protein / WD-40 repeat family protein similar to Pop3 (GI:3434986) [Schizosaccharomyces pombe]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak); Length = 312 Score = 27.9 bits (59), Expect = 6.9 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 8/60 (13%) Frame = +3 Query: 237 NRQKCECW-DLAANQTM-------QVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFWD 392 +R C W L QTM ++ AH++ + C + +P L T S DKT+K W+ Sbjct: 188 DRGTCYVWRSLCERQTMTEFEPLHKLQAHNSHILKC--LLSPGNKYLATASSDKTVKIWN 245 >At1g19485.1 68414.m02427 AT hook motif-containing protein contains Pfam profile: PF00730 HhH-GPD superfamily base excision DNA repair protein; contains Pfam PF02178: AT hook motif; contains Pfam PF00400: WD domain, G-beta repeat (5 copies); contains Prosite PS00354: HMG-I and HMG-Y DNA-binding domain (A+T-hook) Length = 815 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 2/20 (10%) Frame = +1 Query: 628 RGRPRGHPVR--EPDQPQGQ 681 RGRPR HPV EP +P+G+ Sbjct: 212 RGRPRKHPVETTEPKKPRGR 231 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 273 NQTMQVAAHDAPVKTCHWIKAPNYTCLMTTSWDKTLKFW 389 N M + AHD P+++ W NY +++ TLK+W Sbjct: 156 NFEMILQAHDQPIRSMVWSHNENY--MVSGDDGGTLKYW 192 >At4g38670.1 68417.m05475 pathogenesis-related thaumatin family protein similar to receptor serine/threonine kinase PR5K [Arabidopsis thaliana] GI:1235680; contains Pfam profile PF00314: Thaumatin family Length = 281 Score = 27.5 bits (58), Expect = 9.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 293 GARRSSEDLPLDQSAQLHVPHDH 361 G+R+ LPL + +H+PH H Sbjct: 257 GSRKDGATLPLVNKSMIHLPHPH 279 >At3g21060.1 68416.m02662 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to Retinoblastoma-binding protein 5 (RBBP-5) [Homo sapiens](RBQ-3) Length = 547 Score = 27.5 bits (58), Expect = 9.2 Identities = 14/58 (24%), Positives = 25/58 (43%) Frame = +1 Query: 85 TFLIAGSWDCQVRCWEVETSGKTVPKAAQPMDGPVLDVAWHDDGTKVFMASTDKSVNV 258 + L AG D W+ ET G + V+W G ++ +++ DKS+ + Sbjct: 36 SLLAAGCADGGCVIWDFETRGIAKEIRDNDCSAAITSVSWSKYGHRLLVSAADKSLTL 93 >At3g08840.3 68416.m01027 D-alanine--D-alanine ligase family similar to D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine synthetase) (D-Ala-D-Ala ligase) (Swiss-Prot:O51218) [Borrelia burgdorferi]; similar to D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine synthetase) (D-Ala-D-Ala ligase). (Swiss-Prot:P95803) [Streptococcus mutans] Length = 845 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = -3 Query: 126 TSHLAVPAASDQEGVQSDGGRRELEGRHGVIGRRGNLHVL 7 T + V + + Q+ + G RR +E GVIG+RG++H L Sbjct: 780 TDEIIVSSKAKQQ-LSWKGRRRWVEMTVGVIGKRGSMHSL 818 >At3g08840.2 68416.m01026 D-alanine--D-alanine ligase family similar to D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine synthetase) (D-Ala-D-Ala ligase) (Swiss-Prot:O51218) [Borrelia burgdorferi]; similar to D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine synthetase) (D-Ala-D-Ala ligase). (Swiss-Prot:P95803) [Streptococcus mutans] Length = 937 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = -3 Query: 126 TSHLAVPAASDQEGVQSDGGRRELEGRHGVIGRRGNLHVL 7 T + V + + Q+ + G RR +E GVIG+RG++H L Sbjct: 780 TDEIIVSSKAKQQ-LSWKGRRRWVEMTVGVIGKRGSMHSL 818 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,712,815 Number of Sequences: 28952 Number of extensions: 344251 Number of successful extensions: 1340 Number of sequences better than 10.0: 72 Number of HSP's better than 10.0 without gapping: 1138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1328 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -