BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00166 (684 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) /... 30 1.2 At3g05680.1 68416.m00634 expressed protein 29 2.9 At5g40690.1 68418.m04939 expressed protein 29 3.8 At3g58050.1 68416.m06471 expressed protein 29 3.8 At2g40750.1 68415.m05026 WRKY family transcription factor contai... 29 3.8 At1g08170.1 68414.m00902 histone H2B family protein similar to h... 29 3.8 At5g25910.1 68418.m03077 disease resistance family protein conta... 28 5.0 At5g42050.1 68418.m05119 expressed protein similar to gda-1 [Pis... 28 6.6 At3g12560.1 68416.m01563 telomeric DNA-binding protein, putative... 28 6.6 At5g35080.1 68418.m04151 expressed protein 27 8.8 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 27 8.8 At2g31850.1 68415.m03889 expressed protein 27 8.8 At2g20890.1 68415.m02462 expressed protein 27 8.8 >At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) / protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 Length = 1168 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/60 (26%), Positives = 27/60 (45%) Frame = +1 Query: 97 DHDYNLTVATNEDETSCAVLEKIPRAGKRNAEAEVSDSSSNSCEMDTRSRAEGSRARPVP 276 D D T + T+ +L+KIP R+++ E D + + E+ T EG + P Sbjct: 11 DRDPQPTTISTPTSTNAKLLKKIPAIPFRHSDKEGEDEQAKTDEVTTELAGEGPMSHDSP 70 >At3g05680.1 68416.m00634 expressed protein Length = 2057 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = -1 Query: 543 LS*GTNGSVIPFPSLPGLHRSIPYFPSSSKPYCTLPGRT 427 +S GT S P +P L +IP + SS PY +LP RT Sbjct: 1791 ISHGTQSSGGPTRLMPPLPSAIPQY--SSNPYASLPPRT 1827 >At5g40690.1 68418.m04939 expressed protein Length = 210 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 97 DHDYNLTVATNEDETSCAVLEKIPRAGKRNAEAEVSDSSSNSCEMDT 237 DHDY+ E+E +V+E++ + E + SN + DT Sbjct: 129 DHDYDYDEENEEEENRGSVVEEVVNIQSSDDGGETEEEGSNDDDDDT 175 >At3g58050.1 68416.m06471 expressed protein Length = 1209 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 494 PGSEGNGITEP-LVPQLRMASGTGLGHTPSTSRPEPATKSAF 616 P +GN T+P +LR+ S G+G PST+R +K + Sbjct: 803 PVFQGNRYTQPDYTRELRLKSKVGVGPNPSTTRDSLHSKQVW 844 >At2g40750.1 68415.m05026 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 346 Score = 28.7 bits (61), Expect = 3.8 Identities = 19/66 (28%), Positives = 25/66 (37%) Frame = +3 Query: 252 GEPGTSGTPQTASELLLPLKRIDFKLGSNRSDIDSVGDSKPVKPKYRLGRWQIKLLNDMS 431 G SG P EL+ + K S D V S P+ + G W +D + Sbjct: 51 GSGSVSGGPDPVDELMSKILGSFHKTISVLDSFDPVAVSVPIAVE---GSWNASCGDDSA 107 Query: 432 VPVKCN 449 PV CN Sbjct: 108 TPVSCN 113 >At1g08170.1 68414.m00902 histone H2B family protein similar to histone H2B from Chlamydomonas reinhardtii [SP|P54347, SP|P54346, SP|P50565], Volvox carteri [SP|P16867, SP|P16868]; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 243 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +1 Query: 67 FQRVLETCVQDHDYNLTVATNEDETSCAVLEKIPRAGKRNAEAEVSDSSSNSCEMDTRSR 246 F+R+ + + DY + E AV +P R+A AE S + SN D+R R Sbjct: 184 FERIAQEAARLSDYTKRRTLSSREIEAAVRLVLPGELSRHAVAEGSKAVSNFVGYDSRKR 243 >At5g25910.1 68418.m03077 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596; Length = 811 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = -3 Query: 475 IFSIIFKALLHFTGTDMSFSNFICHLPSRYFGLTGLLSPTLSMSDLFEPSLKSIRFK 305 I +++F+ + D+S +N +P FGL L L +DL KSI K Sbjct: 226 ISAVVFENMTDLKHVDLSVNNLTGRIPDVLFGLKNLTELYLFANDLTGEIPKSISAK 282 >At5g42050.1 68418.m05119 expressed protein similar to gda-1 [Pisum sativum] GI:2765418 Length = 349 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/73 (19%), Positives = 34/73 (46%) Frame = +1 Query: 67 FQRVLETCVQDHDYNLTVATNEDETSCAVLEKIPRAGKRNAEAEVSDSSSNSCEMDTRSR 246 F + + T ++ + YN+ + N +I + GK+N + + +++N D ++ Sbjct: 138 FNKGVYTSMKKYGYNVNLKNNNKNKGIDEDHQIQKGGKKNRKNQ--QNNNNQRNEDDKNN 195 Query: 247 AEGSRARPVPPRQ 285 R + +PP + Sbjct: 196 GLDKRFKTLPPAE 208 >At3g12560.1 68416.m01563 telomeric DNA-binding protein, putative similar to telomeric DNA-binding protein 1 [Arabidopsis thaliana] gi|13641340|gb|AAK31590 Length = 619 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +1 Query: 109 NLTVATNEDETSCAVLEKIPRAGKRNAEAEVSDSSSNSCEMDTRSRAEGSR 261 N + ++D T ++ + AGK E+E S +SSN+ E + + E + Sbjct: 32 NKRIDHDDDNTQICAIDLLALAGKILQESESSSASSNAFEEIKQEKVENCK 82 >At5g35080.1 68418.m04151 expressed protein Length = 282 Score = 27.5 bits (58), Expect = 8.8 Identities = 17/71 (23%), Positives = 31/71 (43%) Frame = -3 Query: 517 YPIPLAPRAPPFHPIFSIIFKALLHFTGTDMSFSNFICHLPSRYFGLTGLLSPTLSMSDL 338 Y I P PFHP ++ +L D + F+C+LP +G S ++S + Sbjct: 44 YKIEFLPEDSPFHPGDNLESMVML-----DKHGNRFLCYLPKEEKATSGWTSSQQNISTV 98 Query: 337 FEPSLKSIRFK 305 + + ++ K Sbjct: 99 MMETQQLVKLK 109 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 513 PFPSLPGLHRSIPYFPSSSKPYCTLP 436 P+P P S PY+P PY T P Sbjct: 32 PYPPPPTNQYSAPYYPYPPPPYATPP 57 >At2g31850.1 68415.m03889 expressed protein Length = 113 Score = 27.5 bits (58), Expect = 8.8 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +1 Query: 175 GKRNAEAEVSDSSSNSCEMDTRSRAEGSRARPVP-PRQRRSFYCL*NESISNSA 333 G R +A +S SS+ SC S S PVP P S C + + S SA Sbjct: 59 GLRQDDAGLSGSSTGSCSSPDSSTGSNSVPAPVPSPAPAGSCCCCSSTADSGSA 112 >At2g20890.1 68415.m02462 expressed protein Length = 300 Score = 27.5 bits (58), Expect = 8.8 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = -2 Query: 200 TSASAFRFPALGIFSKTAQLVSS-SLVATVRL*S*SWTQVSNTR*NVTQRSSVRSILHDD 24 T+ S+ FPALG K + SS L + +R+ T+ S R ++ RS+ +S++H Sbjct: 4 TAISSLSFPALGQSDKISNFASSRPLASAIRI----CTKFS--RLSLNSRSTSKSLIHCM 57 Query: 23 SNL 15 SN+ Sbjct: 58 SNV 60 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,510,451 Number of Sequences: 28952 Number of extensions: 389724 Number of successful extensions: 1379 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1377 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -