BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00164 (661 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1630 - 34896021-34896143,34896329-34896403,34896500-348965... 29 3.3 07_03_1291 + 25545749-25546262,25546989-25547669,25547693-255477... 28 5.7 04_04_1035 + 30283456-30283536,30284823-30285359,30285508-302865... 28 7.6 >04_04_1630 - 34896021-34896143,34896329-34896403,34896500-34896556, 34897176-34897352,34897426-34897492,34898043-34898101, 34898188-34898241,34898455-34898604,34898709-34898918, 34898980-34899039,34899399-34899527,34899616-34899720, 34899935-34900024,34900630-34900695,34901047-34901115, 34901348-34901467,34901572-34901634,34901681-34901817, 34902070-34902160,34902298-34902463,34902700-34904172, 34905666-34905940,34906322-34906819,34906996-34907145, 34907840-34907911,34908006-34908266,34908478-34908558, 34908745-34908996,34909323-34909382,34909602-34909853, 34910385-34910549,34910589-34910849,34911267-34912307, 34913398-34913457,34914055-34914165,34914448-34914534, 34915227-34915300,34915397-34915490,34915644-34915689, 34916397-34916521 Length = 2501 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -2 Query: 648 WALSALVMVWWGISYEGVTEPYFCEKGIKHRHKCIKI 538 W + V VWW ++E V PY C I +C K+ Sbjct: 112 WQVGECVAVWWRPNFETVMYPY-CPPHITKPKECKKL 147 >07_03_1291 + 25545749-25546262,25546989-25547669,25547693-25547751, 25549152-25549242,25549330-25549743,25550191-25550243, 25550947-25551177,25551492-25551708,25551790-25551890, 25552446-25552532,25553536-25553676,25553839-25553961, 25554070-25554522,25554931-25555308,25555410-25556060, 25556264-25556368,25556482-25556707,25557204-25557241 Length = 1520 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/49 (26%), Positives = 26/49 (53%) Frame = -3 Query: 317 YSKRHDNLESLKQSVRLAVKNFPWKKCVLLLITGLND*RTVLQPMETTS 171 +SK D L +++Q + + + NF + + +T L + T+LQ T+ Sbjct: 167 FSKATDVLATVQQILSIGISNFVTSRLTVAAMTELQELHTILQSFTLTN 215 >04_04_1035 + 30283456-30283536,30284823-30285359,30285508-30286512, 30286718-30287042,30287563-30287818,30287901-30288117, 30288743-30289095,30289330-30289833,30291267-30292467, 30292614-30292970,30293258-30293495,30294083-30295125, 30295234-30296649,30296731-30296855,30297036-30297314, 30297352-30297382,30298957-30299022,30299447-30299689, 30299848-30299898,30299980-30300071,30300182-30300249, 30300515-30300600,30300720-30300824,30300994-30301127, 30302403-30302436,30302620-30302892,30303019-30303288, 30303384-30303974,30304065-30304214 Length = 3376 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -1 Query: 121 HTVKVINVICNRIFFPLSQYLWQD*VYKNELLFVSLGKT 5 +T+K +++C R FF L +W+D K+ L + T Sbjct: 2095 NTIKYYSILCERRFFELVFLVWRDETPKSLLCILDSATT 2133 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,515,101 Number of Sequences: 37544 Number of extensions: 347745 Number of successful extensions: 760 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -