BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00163 (673 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 27 0.41 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 25 1.6 AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. 25 1.6 AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 25 2.9 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 25 2.9 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 24 3.8 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 24 3.8 AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-b... 24 5.0 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 5.0 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 27.5 bits (58), Expect = 0.41 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -1 Query: 421 LDGGVHFHQSIQEFPGHPAHNNKSQDREI 335 +DGG++ S++ FPG+ A NKS + E+ Sbjct: 167 VDGGLNIPHSVKRFPGYSA-ENKSFNAEM 194 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 25.4 bits (53), Expect = 1.6 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -3 Query: 158 PFIA*LISLYFGAHALFVKDTKLVLVHHFEQLLASRCRVRNV 33 PFIA + + G L + L+H F QL+A R R RNV Sbjct: 265 PFIADHVLVNVGTVDLLHGRAMIDLIHDFNQLVA-RFRERNV 305 >AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. Length = 115 Score = 25.4 bits (53), Expect = 1.6 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 176 CRWRQRQARIPDETGRPDKQPCSSSDAKGHSCYRPRRD 289 C ++ + +P P +PC SSD G SC + D Sbjct: 66 CECKETREPLPYMYACPGTEPCQSSDRLG-SCSKSMHD 102 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 138 QPLLRRPCAFRKRYEACAR 82 Q +RR CAF K++EA R Sbjct: 379 QAHIRRHCAFAKQFEALCR 397 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 138 QPLLRRPCAFRKRYEACAR 82 Q +RR CAF K++EA R Sbjct: 410 QAHIRRHCAFAKQFEALCR 428 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.2 bits (50), Expect = 3.8 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 186 RQRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGIP 52 +Q+ ++HS + + RRP + + P L TTSG P Sbjct: 25 QQQQQLHSADVPHSSTSQSSRRPQHSSTSASSSSVPTLPTTSGEP 69 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.2 bits (50), Expect = 3.8 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 186 RQRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGIP 52 +Q+ ++HS + + RRP + + P L TTSG P Sbjct: 25 QQQQQLHSADVPHSSTSQSSRRPQHSSTSASSSSVPTLPTTSGEP 69 >AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-binding protein OBPjj2 protein. Length = 228 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 214 FIGNPCLSLPPATRS 170 F GNPCL PP ++ Sbjct: 55 FAGNPCLKGPPVPKN 69 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 5.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 41 VPGNGMPEVVRSGGRAQA 94 VPG+G+P SGG A Sbjct: 3225 VPGSGLPAAAASGGAPSA 3242 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 685,248 Number of Sequences: 2352 Number of extensions: 14369 Number of successful extensions: 36 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -