BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00161 (687 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2863| Best HMM Match : Asp (HMM E-Value=1.2e-07) 29 3.5 SB_22056| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_2863| Best HMM Match : Asp (HMM E-Value=1.2e-07) Length = 721 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +1 Query: 376 KKKTQALKIMRRLQQILQQCLMFEFQYFFFGMAS*TSFALSKSIYLKTSLNHRRQHGGHE 555 K QA ++MR+ +++ +F F A + A S+S ++ + H R+H G E Sbjct: 137 KSCVQACRVMRQGRRLY--VYLFIILTFLAVQAVHRARASSQSFDIRKKVKHHRRHNGSE 194 Query: 556 W 558 W Sbjct: 195 W 195 >SB_22056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 481 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -3 Query: 457 NIEIRTSSTVEEFVATVS*FSMLVFFFCLY 368 N+ +R S VEEF+A ++ +SM + FC + Sbjct: 372 NVCLRNSEEVEEFIALLA-YSMQSYLFCYH 400 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,865,444 Number of Sequences: 59808 Number of extensions: 417887 Number of successful extensions: 902 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 901 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -