BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00160 (568 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 23 1.4 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 1.4 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 2.4 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 23 2.4 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 22 4.2 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 5.6 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 23.4 bits (48), Expect = 1.4 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -3 Query: 566 EEIGAVVEIPLDADDPGYVESLEGIFINAIIKLSSFPLY 450 EEI +E LD + P Y + E F++ +IK S LY Sbjct: 322 EEILKEMEAVLDEEPPTYAKLQELKFMDRVIK-ESLRLY 359 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 23.4 bits (48), Expect = 1.4 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -3 Query: 566 EEIGAVVEIPLDADDPGYVESLEGIFINAIIKLSSFPLY 450 EEI +E LD + P Y + E F++ +IK S LY Sbjct: 322 EEILKEMEAVLDEEPPTYAKLQELKFMDRVIK-ESLRLY 359 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.6 bits (46), Expect = 2.4 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +3 Query: 282 LSGRKNKCATLRIYQGIMLTEYHRTYEMLTILHL 383 LSG+ K T +++QG+ +H T +I+ + Sbjct: 621 LSGKGLKKITGKMFQGVRSPTFHLTVRNTSIIKI 654 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 365 HLVRPMILGEHNPLINP 315 H +RP IL + P+ NP Sbjct: 99 HQIRPPILHDTQPMCNP 115 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.8 bits (44), Expect = 4.2 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 113 VG*FVRRALLASDGFDEDGDWVAHW 39 VG V ++AS D W+AHW Sbjct: 236 VGTLVVNDVVASCYATIDSQWLAHW 260 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 21.4 bits (43), Expect = 5.6 Identities = 11/37 (29%), Positives = 14/37 (37%) Frame = -1 Query: 142 CGKKLSGLCLWVNSFVEPFSQATGSTRTVTGWHTGIF 32 CG SG C + PF G+ T+ G F Sbjct: 48 CGPGQSGQCFGPSICCGPFGCLVGTPETLRCQREGFF 84 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,080 Number of Sequences: 336 Number of extensions: 2081 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13995094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -