BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00155 (706 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 75 2e-15 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 25 2.3 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 25 2.3 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 3.1 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 9.4 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 9.4 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 9.4 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 9.4 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 75.4 bits (177), Expect = 2e-15 Identities = 33/84 (39%), Positives = 53/84 (63%) Frame = +1 Query: 256 LVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIATPGRLID 435 +++APTRELA QI F H + ++ +GG + Q + + G +++ATPGRL+D Sbjct: 253 VIVAPTRELAIQIHDEGRKFAHGTKLKVCVSYGGTAVQHQLQLMRGGCHVLVATPGRLLD 312 Query: 436 FLEKGTTNLQRCTYLVLDEADRML 507 F+++G + ++VLDEADRML Sbjct: 313 FIDRGYVTFENVNFVVLDEADRML 336 Score = 43.6 bits (98), Expect = 6e-06 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 4/52 (7%) Frame = +3 Query: 510 MGFEPQIRKIIEQI----RPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 653 MGF P I K++ + RQTLM+SAT+P E+++LA +L +YI + +G Sbjct: 338 MGFLPSIEKVMGHATMPEKQQRQTLMFSATFPAEIQELAGKFLHNYICVFVG 389 Score = 35.1 bits (77), Expect = 0.002 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 24 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 152 ++ FE + + V V+ Y +PTPIQ PI ++G++L+ Sbjct: 173 VESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLM 215 Score = 28.3 bits (60), Expect = 0.25 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +2 Query: 161 RTGSGKTLAYILPAIVHI 214 +TGSGKT A++LP I H+ Sbjct: 219 QTGSGKTAAFMLPMIHHL 236 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 25.0 bits (52), Expect = 2.3 Identities = 10/40 (25%), Positives = 21/40 (52%) Frame = +2 Query: 137 WKEFSWRTRTGSGKTLAYILPAIVHINNQPPIRRGDGPIV 256 +K +++ + + ++ I A+V + Q +RR DG V Sbjct: 456 YKTLNYKAQKAAARSHVKIFKALVRLRKQRTLRRNDGNAV 495 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 25.0 bits (52), Expect = 2.3 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = +1 Query: 367 REQARDLERGVEIVIATPGRLIDFLEKGTTNLQRCTYLVLDEADRMLVWDLNHKSEKSLS 546 +EQA LE E + A RL++ GTT+ L + + +N +S++ + Sbjct: 835 KEQAVKLE---EQIAALQQRLVEV--SGTTDEMTAAVTALKQQIKQHKEKMNSQSKELKA 889 Query: 547 KYAQTDRL 570 KY Q D+L Sbjct: 890 KYHQRDKL 897 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.6 bits (51), Expect = 3.1 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +1 Query: 427 LIDFLEKGTTNLQRCTYLVLDEADR 501 L+ ++E+GT +Q + L++DE + Sbjct: 133 LLQYIEQGTVRVQDISLLIVDECHK 157 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 349 THTCYEHKMCVQNLQQLAEFVVLTL 275 ++ C EH++CV + Q F +TL Sbjct: 199 SYACPEHELCVGRIAQELGFQHVTL 223 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +3 Query: 555 PDRQTLMWSATWPKEVKKLAEDYLGDY 635 P+R+ ++W A ++++ E YLG + Sbjct: 559 PNRERVLWPAHNVRDLRLWTEVYLGSW 585 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 349 THTCYEHKMCVQNLQQLAEFVVLTL 275 ++ C EH++CV + Q F +TL Sbjct: 199 SYACPEHELCVGRIAQELGFQHVTL 223 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +3 Query: 555 PDRQTLMWSATWPKEVKKLAEDYLGDY 635 P+R+ ++W A ++++ E YLG + Sbjct: 559 PNRERVLWPAHNVRDLRLWTEVYLGSW 585 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 813,368 Number of Sequences: 2352 Number of extensions: 17943 Number of successful extensions: 38 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -