BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00154 (799 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45490.1 68415.m05658 protein kinase, putative contains prote... 49 3e-06 At3g23000.1 68416.m02900 CBL-interacting protein kinase 7 (CIPK7... 46 3e-05 At4g14580.1 68417.m02244 CBL-interacting protein kinase 4 (CIPK4... 44 1e-04 At1g01140.3 68414.m00020 CBL-interacting protein kinase 9 (CIPK9... 43 3e-04 At1g01140.1 68414.m00018 CBL-interacting protein kinase 9 (CIPK9... 43 3e-04 At3g29160.3 68416.m03654 Snf1-related protein kinase (KIN11) ide... 42 5e-04 At3g29160.2 68416.m03653 Snf1-related protein kinase (KIN11) ide... 42 5e-04 At3g29160.1 68416.m03652 Snf1-related protein kinase (KIN11) ide... 42 5e-04 At5g21326.1 68418.m02534 protein kinase family protein / NAF dom... 42 6e-04 At5g21222.1 68418.m02532 protein kinase family protein contains ... 42 6e-04 At5g01810.1 68418.m00100 CBL-interacting protein kinase 15 (CIPK... 42 6e-04 At2g25880.1 68415.m03106 serine/threonine protein kinase, putati... 42 6e-04 At1g30270.1 68414.m03702 CBL-interacting protein kinase 23 (CIPK... 41 8e-04 At1g01140.2 68414.m00019 CBL-interacting protein kinase 9 (CIPK9... 41 8e-04 At4g32830.1 68417.m04669 protein kinase, putative similar to pro... 41 0.001 At3g01090.2 68416.m00014 Snf1-related protein kinase (KIN10) (SK... 40 0.002 At3g01090.1 68416.m00013 Snf1-related protein kinase (KIN10) (SK... 40 0.002 At5g66850.1 68418.m08428 protein kinase family protein contains ... 39 0.004 At2g38490.1 68415.m04728 CBL-interacting protein kinase 22, puta... 38 0.006 At2g26980.4 68415.m03240 CBL-interacting protein kinase 3 (CIPK3... 38 0.008 At2g26980.3 68415.m03237 CBL-interacting protein kinase 3 (CIPK3... 38 0.008 At2g26980.2 68415.m03238 CBL-interacting protein kinase 3 (CIPK3... 38 0.008 At2g26980.1 68415.m03239 CBL-interacting protein kinase 3 (CIPK3... 38 0.008 At5g58380.1 68418.m07311 CBL-interacting protein kinase 10 (CIPK... 36 0.024 At5g45820.1 68418.m05635 CBL-interacting protein kinase 20 (CIPK... 36 0.024 At2g30360.1 68415.m03695 CBL-interacting protein kinase 11 (CIPK... 36 0.024 At4g14480.1 68417.m02233 protein kinase family protein contains ... 36 0.031 At2g34180.1 68415.m04183 CBL-interacting protein kinase 13 (CIPK... 36 0.041 At5g57630.1 68418.m07200 CBL-interacting protein kinase 21, puta... 35 0.054 At4g30960.1 68417.m04395 CBL-interacting protein kinase 6 (CIPK6... 35 0.054 At4g24400.1 68417.m03499 CBL-interacting protein kinase 8 (CIPK8... 35 0.054 At5g01820.1 68418.m00101 CBL-interacting protein kinase 14 (CIPK... 35 0.072 At1g29230.1 68414.m03575 CBL-interacting protein kinase 18 (CIPK... 34 0.13 At4g18700.1 68417.m02765 CBL-interacting protein kinase 12 (CIPK... 33 0.17 At1g53570.2 68414.m06081 mitogen-activated protein kinase kinase... 33 0.17 At1g53570.1 68414.m06080 mitogen-activated protein kinase kinase... 33 0.17 At3g63280.1 68416.m07111 protein kinase family protein contains ... 33 0.29 At3g46160.1 68416.m04995 protein kinase-related contains eukaryo... 33 0.29 At4g33950.1 68417.m04818 protein kinase, putative similar to abs... 32 0.38 At1g63700.1 68414.m07209 protein kinase, putative contains prote... 32 0.38 At2g27880.1 68415.m03380 argonaute protein, putative / AGO, puta... 31 0.67 At1g79640.1 68414.m09286 protein kinase family protein contains ... 31 0.67 At5g45810.1 68418.m05633 CBL-interacting protein kinase 19 (CIPK... 31 1.2 At3g17510.2 68416.m02236 CBL-interacting protein kinase 1 (CIPK1... 31 1.2 At3g17510.1 68416.m02237 CBL-interacting protein kinase 1 (CIPK1... 31 1.2 At1g54510.1 68414.m06217 protein kinase family protein contains ... 31 1.2 At3g25250.1 68416.m03154 protein kinase family protein contains ... 30 1.5 At3g10540.1 68416.m01265 3-phosphoinositide-dependent protein ki... 30 1.5 At1g07150.1 68414.m00761 protein kinase family protein contains ... 30 2.0 At5g15680.1 68418.m01834 expressed protein 29 2.7 At4g10730.1 68417.m01753 protein kinase family protein contains ... 29 2.7 At1g48260.1 68414.m05390 CBL-interacting protein kinase 17 (CIPK... 29 2.7 At5g14720.1 68418.m01727 protein kinase family protein contains ... 29 3.6 At4g08480.1 68417.m01399 mitogen-activated protein kinase, putat... 29 3.6 At4g08470.1 68417.m01398 mitogen-activated protein kinase, putat... 29 3.6 At5g63610.1 68418.m07986 protein kinase, putative similar to cyc... 28 6.2 At4g08500.1 68417.m01401 mitogen-activated protein kinase kinase... 28 6.2 At1g70430.1 68414.m08103 protein kinase family protein contains ... 28 6.2 At1g54960.1 68414.m06277 NPK1-related protein kinase, putative (... 28 6.2 At1g09000.1 68414.m01004 NPK1-related protein kinase, putative (... 28 6.2 At4g22120.1 68417.m03198 early-responsive to dehydration protein... 28 8.3 At3g04530.1 68416.m00480 phosphoenolpyruvate carboxylase kinase ... 28 8.3 At2g33550.1 68415.m04112 gt-2-related weak similarity to gt-2 (G... 28 8.3 >At2g45490.1 68415.m05658 protein kinase, putative contains protein kinase domain, Pfam:PF00069; similar to protein kinase p46XlEg22 [Xenopus laevis] gi|609280|emb|CAA78914 Length = 288 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 2/73 (2%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIP--SSLRKPAASMIVLQLQSNPARRPSVDKLLQHEF 174 G PPFE + KDT+KRI + + P ++ + A ++I L +P++R S++K++QH + Sbjct: 213 GNPPFEAESQKDTFKRILKIDLSFPLTPNVSEEAKNLISQLLVKDPSKRLSIEKIMQHPW 272 Query: 175 FSSGILPAGLPVS 213 P G+ S Sbjct: 273 IVKNADPKGVCAS 285 >At3g23000.1 68416.m02900 CBL-interacting protein kinase 7 (CIPK7) identical to CBL-interacting protein kinase 7 [Arabidopsis thaliana] gi|13249113|gb|AAK16682; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain; identical to cDNA CBL-interacting protein kinase 7 (CIPK7) GI:13249112 Length = 429 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/63 (31%), Positives = 35/63 (55%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ S + Y++I + +YR PS + K A S+I L NP R S++ +++ +F Sbjct: 222 GDVPFDDSNIAAMYRKIHRRDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWFK 281 Query: 181 SGI 189 + Sbjct: 282 KSL 284 >At4g14580.1 68417.m02244 CBL-interacting protein kinase 4 (CIPK4) identical to CBL-interacting protein kinase 4 [Arabidopsis thaliana] gi|13249503|gb|AAG01367; identical to cDNA calcineurin B-like (CBL) interacting protein kinase 4 (CIPK4) GI:13249502 Length = 426 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/63 (31%), Positives = 35/63 (55%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ + + Y++I + +YR PS + KPA S+I L NP R S++ ++ +F Sbjct: 219 GYVPFDDANIVAMYRKIHKRDYRFPSWISKPARSIIYKLLDPNPETRMSIEAVMGTVWFQ 278 Query: 181 SGI 189 + Sbjct: 279 KSL 281 >At1g01140.3 68414.m00020 CBL-interacting protein kinase 9 (CIPK9) identical to CBL-interacting protein kinase 9 [Arabidopsis thaliana] gi|13249117|gb|AAK16684; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain; identical to cDNA CBL-interacting protein kinase 9 (CIPK9) GI:13249116 Length = 451 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/65 (35%), Positives = 33/65 (50%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ L YKRI + E+ P + A +I L+ NP R S+ +LL+ E+F Sbjct: 216 GYLPFDEPNLMTLYKRICKAEFSCPPWFSQGAKRVIKRILEPNPITRISIAELLEDEWFK 275 Query: 181 SGILP 195 G P Sbjct: 276 KGYKP 280 >At1g01140.1 68414.m00018 CBL-interacting protein kinase 9 (CIPK9) identical to CBL-interacting protein kinase 9 [Arabidopsis thaliana] gi|13249117|gb|AAK16684; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain; identical to cDNA CBL-interacting protein kinase 9 (CIPK9) GI:13249116 Length = 447 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/65 (35%), Positives = 33/65 (50%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ L YKRI + E+ P + A +I L+ NP R S+ +LL+ E+F Sbjct: 216 GYLPFDEPNLMTLYKRICKAEFSCPPWFSQGAKRVIKRILEPNPITRISIAELLEDEWFK 275 Query: 181 SGILP 195 G P Sbjct: 276 KGYKP 280 >At3g29160.3 68416.m03654 Snf1-related protein kinase (KIN11) identical to protein kinase AKin11 GI:1729444 from [Arabidopsis thaliana] Length = 359 Score = 41.9 bits (94), Expect = 5e-04 Identities = 23/71 (32%), Positives = 38/71 (53%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ + + +K+IK Y +PS L A +I L +P +R ++ ++ QH +F Sbjct: 214 GTLPFDDENIPNLFKKIKGGIYTLPSHLSSEARDLIPRMLIVDPVKRITIPEIRQHRWFQ 273 Query: 181 SGILPAGLPVS 213 + LP L VS Sbjct: 274 TH-LPRYLAVS 283 >At3g29160.2 68416.m03653 Snf1-related protein kinase (KIN11) identical to protein kinase AKin11 GI:1729444 from [Arabidopsis thaliana] Length = 512 Score = 41.9 bits (94), Expect = 5e-04 Identities = 23/71 (32%), Positives = 38/71 (53%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ + + +K+IK Y +PS L A +I L +P +R ++ ++ QH +F Sbjct: 214 GTLPFDDENIPNLFKKIKGGIYTLPSHLSSEARDLIPRMLIVDPVKRITIPEIRQHRWFQ 273 Query: 181 SGILPAGLPVS 213 + LP L VS Sbjct: 274 TH-LPRYLAVS 283 >At3g29160.1 68416.m03652 Snf1-related protein kinase (KIN11) identical to protein kinase AKin11 GI:1729444 from [Arabidopsis thaliana] Length = 512 Score = 41.9 bits (94), Expect = 5e-04 Identities = 23/71 (32%), Positives = 38/71 (53%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ + + +K+IK Y +PS L A +I L +P +R ++ ++ QH +F Sbjct: 214 GTLPFDDENIPNLFKKIKGGIYTLPSHLSSEARDLIPRMLIVDPVKRITIPEIRQHRWFQ 273 Query: 181 SGILPAGLPVS 213 + LP L VS Sbjct: 274 TH-LPRYLAVS 283 >At5g21326.1 68418.m02534 protein kinase family protein / NAF domain-containing protein contains Pfam profiles: PF00069 protein kinase domain, PF03822 NAF domain Length = 439 Score = 41.5 bits (93), Expect = 6e-04 Identities = 24/66 (36%), Positives = 32/66 (48%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PFE S L YK+I EY P L A ++IV L NP R ++ ++L +F Sbjct: 210 GYLPFEDSNLMTLYKKIIAGEYHCPPWLSPGAKNLIVRILDPNPMTRITIPEVLGDAWFK 269 Query: 181 SGILPA 198 PA Sbjct: 270 KNYKPA 275 >At5g21222.1 68418.m02532 protein kinase family protein contains Pfam profile: PF00069 protein kinase domain Length = 831 Score = 41.5 bits (93), Expect = 6e-04 Identities = 21/66 (31%), Positives = 33/66 (50%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PFE S+L YK+I ++ P L ++IV L NP R ++ ++L+ +F Sbjct: 210 GYLPFEDSSLTTLYKKISSADFSCPPWLSSGVKNLIVRILDPNPMTRITIPEILEDVWFK 269 Query: 181 SGILPA 198 PA Sbjct: 270 KDYKPA 275 >At5g01810.1 68418.m00100 CBL-interacting protein kinase 15 (CIPK15) identical to CBL-interacting protein kinase 15 [Arabidopsis thaliana] gi|13249134|gb|AAK16692; identical to novel serine/threonine protein kinase [Arabidopsis thaliana] gi|1777312|dbj|BAA06311; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain Length = 421 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/63 (31%), Positives = 33/63 (52%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF S L + YK+I + E + P+ L A ++ L NP R S +K+++ +F Sbjct: 208 GYLPFRDSNLMELYKKIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWFR 267 Query: 181 SGI 189 G+ Sbjct: 268 KGL 270 >At2g25880.1 68415.m03106 serine/threonine protein kinase, putative similar to serine/threonine kinase Ayk1 [Mus musculus] gi|1763647|gb|AAB62982 Length = 282 Score = 41.5 bits (93), Expect = 6e-04 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSS--LRKPAASMIVLQLQSNPARRPSVDKLLQHEF 174 G PPFE +TYKRI Q + + P + A +I L +R ++ KLL+H + Sbjct: 210 GVPPFEAREHSETYKRIVQVDLKFPPKPIVSSSAKDLISQMLVKESTQRLALHKLLEHPW 269 Query: 175 FSSGILPAGL 204 P+GL Sbjct: 270 IVQNADPSGL 279 >At1g30270.1 68414.m03702 CBL-interacting protein kinase 23 (CIPK23) identical to CBL-interacting protein kinase 23 [Arabidopsis thaliana] gi|14486386|gb|AAK61494 Length = 482 Score = 41.1 bits (92), Expect = 8e-04 Identities = 21/62 (33%), Positives = 32/62 (51%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PFE S L YK+I + E+ P A +I L NPA R + +++++E+F Sbjct: 228 GYLPFEDSNLTSLYKKIFKAEFTCPPWFSASAKKLIKRILDPNPATRITFAEVIENEWFK 287 Query: 181 SG 186 G Sbjct: 288 KG 289 >At1g01140.2 68414.m00019 CBL-interacting protein kinase 9 (CIPK9) identical to CBL-interacting protein kinase 9 [Arabidopsis thaliana] gi|13249117|gb|AAK16684; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain; identical to cDNA CBL-interacting protein kinase 9 (CIPK9) GI:13249116 Length = 449 Score = 41.1 bits (92), Expect = 8e-04 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQC--EYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEF 174 G PF+ L YKR++ C E+ P + A +I L+ NP R S+ +LL+ E+ Sbjct: 216 GYLPFDEPNLMTLYKRVRICKAEFSCPPWFSQGAKRVIKRILEPNPITRISIAELLEDEW 275 Query: 175 FSSGILP 195 F G P Sbjct: 276 FKKGYKP 282 >At4g32830.1 68417.m04669 protein kinase, putative similar to protein kinase p46XlEg22 [Xenopus laevis] gi|609280|emb|CAA78914; contains protein kinase domain, Pfam:PF00069 Length = 294 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSS--LRKPAASMIVLQLQSNPARRPSVDKLLQHEF 174 G PPFE DTY+RI Q + + P + A +I L ++R + KLL+H + Sbjct: 222 GVPPFEAMEHSDTYRRIVQVDLKFPPKPIISASAKDLISQMLVKESSQRLPLHKLLEHPW 281 Query: 175 FSSGILPAGL 204 P+G+ Sbjct: 282 IVQNADPSGI 291 >At3g01090.2 68416.m00014 Snf1-related protein kinase (KIN10) (SKIN10) identical to Snf1-related protein kinase, KIN10 SP:Q38997 from [Arabidopsis thaliana] Length = 535 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/83 (27%), Positives = 42/83 (50%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ + + +K+IK Y +PS L A +I L +P +R ++ ++ QH +F Sbjct: 236 GTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRVTIPEIRQHPWFQ 295 Query: 181 SGILPAGLPVSCLTTAPRTDQLE 249 + LP L V T + +++ Sbjct: 296 AH-LPRYLAVPPPDTVQQAKKID 317 >At3g01090.1 68416.m00013 Snf1-related protein kinase (KIN10) (SKIN10) identical to Snf1-related protein kinase, KIN10 SP:Q38997 from [Arabidopsis thaliana] Length = 512 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/83 (27%), Positives = 42/83 (50%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ + + +K+IK Y +PS L A +I L +P +R ++ ++ QH +F Sbjct: 213 GTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRVTIPEIRQHPWFQ 272 Query: 181 SGILPAGLPVSCLTTAPRTDQLE 249 + LP L V T + +++ Sbjct: 273 AH-LPRYLAVPPPDTVQQAKKID 294 >At5g66850.1 68418.m08428 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain; identical to cDNA MAP3K gamma protein kinase GI:2315152 Length = 716 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/65 (29%), Positives = 29/65 (44%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 GKPP+ ++ + IP S+ + L Q NPA RP+ LL+H F Sbjct: 549 GKPPWSEFEGAAAMFKVMRDSPPIPESMSPEGKDFLRLCFQRNPAERPTASMLLEHRFLK 608 Query: 181 SGILP 195 + + P Sbjct: 609 NSLQP 613 >At2g38490.1 68415.m04728 CBL-interacting protein kinase 22, putative (CIPK22) identical to CBL-interacting protein kinase 22 [Arabidopsis thaliana] gi|17902248|gb|AAL47845 Length = 455 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/66 (24%), Positives = 35/66 (53%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF + Y++I + +Y++P ++ L+ NP R +V+++L+ +F+ Sbjct: 248 GYLPFRDPNIMGLYRKIHKAQYKLPDWTSSDLRKLLRRLLEPNPELRITVEEILKDPWFN 307 Query: 181 SGILPA 198 G+ P+ Sbjct: 308 HGVDPS 313 >At2g26980.4 68415.m03240 CBL-interacting protein kinase 3 (CIPK3) identical to CBL-interacting protein kinase 3 [Arabidopsis thaliana] gi|9280638|gb|AAF86507 Length = 382 Score = 37.9 bits (84), Expect = 0.008 Identities = 20/65 (30%), Positives = 30/65 (46%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ S L + YK+I E+ P L A +I L NP R + ++ + E+F Sbjct: 211 GYLPFDDSNLMNLYKKISSGEFNCPPWLSLGAMKLITRILDPNPMTRVTPQEVFEDEWFK 270 Query: 181 SGILP 195 P Sbjct: 271 KDYKP 275 >At2g26980.3 68415.m03237 CBL-interacting protein kinase 3 (CIPK3) identical to CBL-interacting protein kinase 3 [Arabidopsis thaliana] gi|9280638|gb|AAF86507 Length = 441 Score = 37.9 bits (84), Expect = 0.008 Identities = 20/65 (30%), Positives = 30/65 (46%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ S L + YK+I E+ P L A +I L NP R + ++ + E+F Sbjct: 211 GYLPFDDSNLMNLYKKISSGEFNCPPWLSLGAMKLITRILDPNPMTRVTPQEVFEDEWFK 270 Query: 181 SGILP 195 P Sbjct: 271 KDYKP 275 >At2g26980.2 68415.m03238 CBL-interacting protein kinase 3 (CIPK3) identical to CBL-interacting protein kinase 3 [Arabidopsis thaliana] gi|9280638|gb|AAF86507 Length = 375 Score = 37.9 bits (84), Expect = 0.008 Identities = 20/65 (30%), Positives = 30/65 (46%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ S L + YK+I E+ P L A +I L NP R + ++ + E+F Sbjct: 211 GYLPFDDSNLMNLYKKISSGEFNCPPWLSLGAMKLITRILDPNPMTRVTPQEVFEDEWFK 270 Query: 181 SGILP 195 P Sbjct: 271 KDYKP 275 >At2g26980.1 68415.m03239 CBL-interacting protein kinase 3 (CIPK3) identical to CBL-interacting protein kinase 3 [Arabidopsis thaliana] gi|9280638|gb|AAF86507 Length = 382 Score = 37.9 bits (84), Expect = 0.008 Identities = 20/65 (30%), Positives = 30/65 (46%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ S L + YK+I E+ P L A +I L NP R + ++ + E+F Sbjct: 211 GYLPFDDSNLMNLYKKISSGEFNCPPWLSLGAMKLITRILDPNPMTRVTPQEVFEDEWFK 270 Query: 181 SGILP 195 P Sbjct: 271 KDYKP 275 >At5g58380.1 68418.m07311 CBL-interacting protein kinase 10 (CIPK10) identical to CBL-interacting protein kinase 10 [Arabidopsis thaliana] gi|13249119|gb|AAK16685; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain; identical to cDNA CBL-interacting protein kinase 10 (CIPK10) GI:13249118 Length = 479 Score = 36.3 bits (80), Expect = 0.024 Identities = 15/63 (23%), Positives = 31/63 (49%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF S L + Y++I + +++ PS ++ L NP R ++ ++ + +F Sbjct: 208 GYLPFHDSNLMEMYRKIGKADFKAPSWFAPEVRRLLCKMLDPNPETRITIARIRESSWFR 267 Query: 181 SGI 189 G+ Sbjct: 268 KGL 270 >At5g45820.1 68418.m05635 CBL-interacting protein kinase 20 (CIPK20) identical to CBL-interacting protein kinase 20 [Arabidopsis thaliana] gi|14486384|gb|AAK61493 Length = 439 Score = 36.3 bits (80), Expect = 0.024 Identities = 16/68 (23%), Positives = 32/68 (47%) Frame = +1 Query: 10 PFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFSSGI 189 PF L + Y++I + E++ P+ ++ L NP R ++K++++ +F G Sbjct: 211 PFHEQNLVEMYRKITKGEFKCPNWFPPEVKKLLSRILDPNPNSRIKIEKIMENSWFQKGF 270 Query: 190 LPAGLPVS 213 P S Sbjct: 271 KKIETPKS 278 >At2g30360.1 68415.m03695 CBL-interacting protein kinase 11 (CIPK11) identical to CBL-interacting protein kinase 11 [Arabidopsis thaliana] gi|13249121|gb|AAK16686; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain; identical to cDNA CBL-interacting protein kinase 11 (CIPK11)partial cds GI:13249120 Length = 435 Score = 36.3 bits (80), Expect = 0.024 Identities = 18/62 (29%), Positives = 30/62 (48%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF + + YK+I + EYR P + + L NP R ++D++L+ +F Sbjct: 219 GYLPFNDPNVMNMYKKIYKGEYRFPRWMSPDLKRFVSRLLDINPETRITIDEILKDPWFV 278 Query: 181 SG 186 G Sbjct: 279 RG 280 >At4g14480.1 68417.m02233 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 487 Score = 35.9 bits (79), Expect = 0.031 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 9/68 (13%) Frame = +1 Query: 7 PPFETSTLKDTYKRIKQCEYRIPSS---------LRKPAASMIVLQLQSNPARRPSVDKL 159 PP ++ +K T KR +Y I +S K M+ L L+ +P +RPS +KL Sbjct: 229 PPLKSLLMKIT-KRFHFSDYEINTSGSSKKGNKKFSKAFREMVGLCLEQDPTKRPSAEKL 287 Query: 160 LQHEFFSS 183 L+H FF + Sbjct: 288 LKHPFFKN 295 >At2g34180.1 68415.m04183 CBL-interacting protein kinase 13 (CIPK13) identical to CBL-interacting protein kinase 13 [Arabidopsis thaliana] gi|13249125|gb|AAK16688 Length = 502 Score = 35.5 bits (78), Expect = 0.041 Identities = 14/62 (22%), Positives = 31/62 (50%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ + Y +I + +++ P A ++ L +NP R ++ ++++H +F Sbjct: 253 GYLPFDDKNILVMYTKIYKGQFKCPKWFSPELARLVTRMLDTNPDTRITIPEIMKHRWFK 312 Query: 181 SG 186 G Sbjct: 313 KG 314 >At5g57630.1 68418.m07200 CBL-interacting protein kinase 21, putative (CIPK21) identical to CBL-interacting protein kinase 21 [Arabidopsis thaliana] gi|14334390|gb|AAK59696 Length = 416 Score = 35.1 bits (77), Expect = 0.054 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSV-DKLLQHEFF 177 G PPF+ TL YK+I + +Y P +I L NP R ++ + +++ +F Sbjct: 205 GYPPFDDHTLPVLYKKILRADYTFPPGFTGEQKRLIFNILDPNPLSRITLAEIIIKDSWF 264 Query: 178 SSGILP 195 G P Sbjct: 265 KIGYTP 270 >At4g30960.1 68417.m04395 CBL-interacting protein kinase 6 (CIPK6) identical to CBL-interacting protein kinase 6 [Arabidopsis thaliana] gi|9280634|gb|AAF86505 Length = 441 Score = 35.1 bits (77), Expect = 0.054 Identities = 15/59 (25%), Positives = 31/59 (52%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFF 177 G PF+ L + Y++I + +++ P L A ++ L NP R +++K++ +F Sbjct: 220 GYLPFQDDNLVNMYRKIYRGDFKCPGWLSSDARRLVTKLLDPNPNTRITIEKVMDSPWF 278 >At4g24400.1 68417.m03499 CBL-interacting protein kinase 8 (CIPK8) identical to CBL-interacting protein kinase 8 [Arabidopsis thaliana] GP|13249115|gb|AAK16683; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain Length = 445 Score = 35.1 bits (77), Expect = 0.054 Identities = 20/68 (29%), Positives = 31/68 (45%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF+ L Y +I + E+ PS A S+I L NP R ++ ++ + E+F Sbjct: 204 GYLPFDEMDLPTLYSKIDKAEFSCPSYFALGAKSLINRILDPNPETRITIAEIRKDEWFL 263 Query: 181 SGILPAGL 204 P L Sbjct: 264 KDYTPVQL 271 >At5g01820.1 68418.m00101 CBL-interacting protein kinase 14 (CIPK14) identical to CBL-interacting protein kinase 14 [Arabidopsis thaliana] gi|13249127|gb|AAK16689; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain; identical to cDNA CBL-interacting protein kinase 14 (CIPK14) GI:13249126 Length = 442 Score = 34.7 bits (76), Expect = 0.072 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF L Y++I + E+RIP ++ L +NP R ++++++ +F Sbjct: 218 GYLPFNDHNLMVMYRKIYKGEFRIPKWTSPDLRRLLTRLLDTNPQTRITIEEIIHDPWFK 277 Query: 181 SG 186 G Sbjct: 278 QG 279 >At1g29230.1 68414.m03575 CBL-interacting protein kinase 18 (CIPK18) identical to CBL-interacting protein kinase 18 [Arabidopsis thaliana] gi|14334388|gb|AAK59695 Length = 520 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/62 (24%), Positives = 30/62 (48%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF + YK+I + E+R P ++ L +NP R ++ +++++ +F Sbjct: 270 GHIPFYDKNIMVMYKKIYKGEFRCPRWFSSDLVRLLTRLLDTNPDTRITIPEIMKNRWFK 329 Query: 181 SG 186 G Sbjct: 330 KG 331 >At4g18700.1 68417.m02765 CBL-interacting protein kinase 12 (CIPK12) identical to CBL-interacting protein kinase 12 [Arabidopsis thaliana] gi|13249123|gb|AAK16687; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain; identical to cDNA CBL-interacting protein kinase 12 (CIPK12) GI:13249122 Length = 489 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/62 (24%), Positives = 31/62 (50%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 G PF + YK+I + E+R P ++ L++NP +R + +++++ +F Sbjct: 222 GYLPFHDRNVMAMYKKIYRGEFRCPRWFSTELTRLLSKLLETNPEKRFTFPEIMENSWFK 281 Query: 181 SG 186 G Sbjct: 282 KG 283 >At1g53570.2 68414.m06081 mitogen-activated protein kinase kinase kinase (MAPKKK), putative (MAP3Ka) identical to MEK kinase (MAP3Ka)[Arabidopsis thaliana] gi|4204912|gb|AAD10848 Length = 608 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 70 IPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEF 174 IP L A + I L LQ NP RP+ +LL+H F Sbjct: 435 IPDHLSNDAKNFIRLCLQRNPTVRPTASQLLEHPF 469 >At1g53570.1 68414.m06080 mitogen-activated protein kinase kinase kinase (MAPKKK), putative (MAP3Ka) identical to MEK kinase (MAP3Ka)[Arabidopsis thaliana] gi|4204912|gb|AAD10848 Length = 609 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 70 IPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEF 174 IP L A + I L LQ NP RP+ +LL+H F Sbjct: 435 IPDHLSNDAKNFIRLCLQRNPTVRPTASQLLEHPF 469 >At3g63280.1 68416.m07111 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 555 Score = 32.7 bits (71), Expect = 0.29 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +1 Query: 4 KPPFETSTLKDTYKRI-KQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQH 168 KPPF+ S ++ +I K IP+ +I L+ NP RPS ++LL H Sbjct: 200 KPPFKASDVQTLITKIHKLIMDPIPAMYSGSFRGLIKSMLRKNPELRPSANELLNH 255 >At3g46160.1 68416.m04995 protein kinase-related contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 393 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +1 Query: 70 IPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEF 174 IP+ L A + L+ +P++R SVD LL+HEF Sbjct: 297 IPNYLSDKAKDFLAKCLERDPSKRWSVDSLLEHEF 331 >At4g33950.1 68417.m04818 protein kinase, putative similar to abscisic acid-activated protein kinase [Vicia faba] gi|6739629|gb|AAF27340; contains protein kinase domain, Pfam:PF00069 Length = 362 Score = 32.3 bits (70), Expect = 0.38 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +1 Query: 10 PFETSTLKDTYKRIKQCEYRIPSSLR-KPAASMIVLQL-QSNPARRPSVDKLLQHEFFSS 183 P E + T RI +Y IP + P ++ ++ ++PA+R S+ ++ HE+F Sbjct: 220 PEEPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLK 279 Query: 184 GILPAGL 204 LPA L Sbjct: 280 N-LPADL 285 >At1g63700.1 68414.m07209 protein kinase, putative contains protein kinase domain, Pfam:PF00069; similar to MEK kinase (MAP3Ka) [Arabidopsis thaliana] gi|4204912|gb|AAD10848 Length = 883 Score = 32.3 bits (70), Expect = 0.38 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 70 IPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFSSGILPAGLPV 210 IP L + + LQ NPA RP+ +LL H F + ++P P+ Sbjct: 621 IPDHLSEEGKDFVRKCLQRNPANRPTAAQLLDHAFVRN-VMPMERPI 666 >At2g27880.1 68415.m03380 argonaute protein, putative / AGO, putative similar to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 997 Score = 31.5 bits (68), Expect = 0.67 Identities = 20/62 (32%), Positives = 30/62 (48%) Frame = +1 Query: 325 SNANYPRGATSRGTNVAPPEFYCTARPARCIVG*QAEMPTGGSDRRAERSRSTAAGVGWQ 504 +N Y ++ ++ PP +Y R ++EM GGS RSRS+ GVG Q Sbjct: 924 NNLCYTYARCTKSVSIVPPAYYAHLAAFRARYYMESEMSDGGS----SRSRSSTTGVG-Q 978 Query: 505 VV 510 V+ Sbjct: 979 VI 980 >At1g79640.1 68414.m09286 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 694 Score = 31.5 bits (68), Expect = 0.67 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 61 EYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFF 177 +Y + MI L +P++RPS KLL+H FF Sbjct: 236 DYERDKKFSRSFKQMIASCLVKDPSKRPSAKKLLKHSFF 274 >At5g45810.1 68418.m05633 CBL-interacting protein kinase 19 (CIPK19) identical to CBL-interacting protein kinase 19 [Arabidopsis thaliana] gi|14009296|gb|AAK50347 Length = 483 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/59 (22%), Positives = 29/59 (49%) Frame = +1 Query: 10 PFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFSSG 186 PF + YK+I + ++R P +++ L++ P RR ++ +++ +F G Sbjct: 227 PFHDRNVMAMYKKIYRGDFRCPRWFPVEINRLLIRMLETKPERRFTMPDIMETSWFKKG 285 >At3g17510.2 68416.m02236 CBL-interacting protein kinase 1 (CIPK1) identical to CBL-interacting protein kinase 1 [Arabidopsis thaliana] gi|11066952|gb|AAG28776; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain; identical to cDNA CBL-interacting protein kinase 1 (CIPK1) GI:11066951 Length = 364 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = +1 Query: 10 PFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFSSGI 189 PF+ L Y++I + + IP L A +MI L NP R +V + E+F Sbjct: 140 PFDDRNLAVLYQKICKGDPPIPRWLSPGARTMIKRMLDPNPVTRITVVGIKASEWFKLEY 199 Query: 190 LPA 198 +P+ Sbjct: 200 IPS 202 >At3g17510.1 68416.m02237 CBL-interacting protein kinase 1 (CIPK1) identical to CBL-interacting protein kinase 1 [Arabidopsis thaliana] gi|11066952|gb|AAG28776; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain; identical to cDNA CBL-interacting protein kinase 1 (CIPK1) GI:11066951 Length = 444 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = +1 Query: 10 PFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFSSGI 189 PF+ L Y++I + + IP L A +MI L NP R +V + E+F Sbjct: 220 PFDDRNLAVLYQKICKGDPPIPRWLSPGARTMIKRMLDPNPVTRITVVGIKASEWFKLEY 279 Query: 190 LPA 198 +P+ Sbjct: 280 IPS 282 >At1g54510.1 68414.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 612 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 1/73 (1%) Frame = +1 Query: 4 KPPFETSTLKDTYKRI-KQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFS 180 KP F+ ++ +I K +P+ P ++ L+ NP RPS LL+H Sbjct: 200 KPAFKAFDMQALINKINKTIVSPLPAKYSGPFRGLVKSMLRKNPEVRPSASDLLRHPHLQ 259 Query: 181 SGILPAGLPVSCL 219 +L L ++ L Sbjct: 260 PYVLDVKLRLNNL 272 >At3g25250.1 68416.m03154 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 421 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/59 (28%), Positives = 29/59 (49%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFF 177 G PF S K+T+ RI + +I L+ +P+RR +V+++ H+FF Sbjct: 272 GATPFRGSNRKETFYRILSKPPNLTGETTS-LRDLIRRLLEKDPSRRINVEEIKGHDFF 329 >At3g10540.1 68416.m01265 3-phosphoinositide-dependent protein kinase, putative similar to 3-phosphoinositide-dependent protein kinase-1 [Oryza sativa] gi|5001830|gb|AAD37166 Length = 486 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 5/64 (7%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSV-----DKLLQ 165 G PF+ ++ ++RI + + P+ + A +I L ++P+RRP D L + Sbjct: 249 GTSPFKDASEWLIFQRIIARDIKFPNHFSEAARDLIDRLLDTDPSRRPGAGSEGYDSLKR 308 Query: 166 HEFF 177 H FF Sbjct: 309 HPFF 312 >At1g07150.1 68414.m00761 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 499 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYR--IPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEF 174 GKP +E + D+ RI + PS L + + L+ +P +R S D+LLQH F Sbjct: 220 GKPAWEDHGI-DSLSRISFSDELPVFPSKLSEIGRDFLEKCLKRDPNQRWSCDQLLQHPF 278 Query: 175 FS 180 S Sbjct: 279 LS 280 >At5g15680.1 68418.m01834 expressed protein Length = 2151 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/55 (29%), Positives = 22/55 (40%) Frame = -1 Query: 379 AVRRWFHGSWPRGGSSRLTGESTAIVSCSLA*TSLRGRRCTRCPRAGQCAALW*G 215 A+ RW P+G + T + V C +R C CP+ G LW G Sbjct: 65 ALLRWRESESPKGANDASTFQRKLAVECIFCSACIRFVEC--CPQEGLTEKLWSG 117 >At4g10730.1 68417.m01753 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 708 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 61 EYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFSS 183 +Y K ++ L L + +RP+ +KLL+H FF + Sbjct: 270 DYDRDKKFSKSFKELVALCLVKDQTKRPTAEKLLKHSFFKN 310 >At1g48260.1 68414.m05390 CBL-interacting protein kinase 17 (CIPK17) identical to CBL-interacting protein kinase 17 [Arabidopsis thaliana] gi|14571553|gb|AAK64513 Length = 432 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/63 (25%), Positives = 30/63 (47%) Frame = +1 Query: 10 PFETSTLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFFSSGI 189 PF+ + L ++I + + IP + A +MI L NP R ++ + H++F Sbjct: 211 PFDDANLAVICRKIFKGDPPIPRWISLGAKTMIKRMLDPNPVTRVTIAGIKAHDWFKHDY 270 Query: 190 LPA 198 P+ Sbjct: 271 TPS 273 >At5g14720.1 68418.m01727 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 674 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 61 EYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFF 177 +Y K M+ L +P +RP+ +KLL+H FF Sbjct: 239 DYERDKRFSKAFKEMVGTCLVKDPKKRPTSEKLLKHPFF 277 >At4g08480.1 68417.m01399 mitogen-activated protein kinase, putative similar to mitogen-activated protein kinase [Arabidopsis thaliana] gi|1255448|dbj|BAA09057; contains Pfam PF00069: Protein kinase domain Length = 773 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 70 IPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEF 174 +P +L A I+ L+ NP RP+ +LL H F Sbjct: 720 VPDTLSLDARHFILKCLKLNPEERPTATELLNHPF 754 >At4g08470.1 68417.m01398 mitogen-activated protein kinase, putative similar to mitogen-activated protein kinase [Arabidopsis thaliana] gi|1255448|dbj|BAA09057; contains Pfam PF00069: Protein kinase domain Length = 560 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 70 IPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEF 174 +P +L A I+ L+ NP RP+ +LL H F Sbjct: 522 VPDTLSLDARHFILTCLKVNPEERPTAAELLHHPF 556 >At5g63610.1 68418.m07986 protein kinase, putative similar to cyclin-dependent kinase cdc2MsE [Medicago sativa] gi|1806144|emb|CAA65981; contains protein kinase domain, Pfam:PF00069 Length = 470 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +1 Query: 85 RKPAASMIVLQLQSNPARRPSVDKLLQHEFFSSGILP 195 + PA ++ L+ +P +R + + L+HE+F LP Sbjct: 303 KSPAYDLLSKMLEYDPLKRITASQALEHEYFRMDPLP 339 >At4g08500.1 68417.m01401 mitogen-activated protein kinase kinase, putative similar to mitogen-activated protein kinase MEKK1 GP|1255448 [Arabidopsis thaliana] Length = 608 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 70 IPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEF 174 +P +L A I+ L+ NP RP+ +LL H F Sbjct: 552 VPDTLSLDARLFILKCLKVNPEERPTAAELLNHPF 586 >At1g70430.1 68414.m08103 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 594 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 61 EYRIPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEFF 177 +Y K +I L +P +RP+ KLL+H FF Sbjct: 228 DYDRDKKFSKSFRELIAACLVKDPKKRPTAAKLLKHPFF 266 >At1g54960.1 68414.m06277 NPK1-related protein kinase, putative (ANP2) similar to protein kinase [Nicotiana tabacum] gi|456309|dbj|BAA05648; identical to cDNA NPK1-related protein kinase 2, partial cds GI:2342424 Length = 596 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 70 IPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEF 174 IP ++ A ++ LQ P RP+ +LL+H F Sbjct: 295 IPDNISSDANDFLLKCLQQEPNLRPTASELLKHPF 329 >At1g09000.1 68414.m01004 NPK1-related protein kinase, putative (ANP1) similar to protein kinase [Nicotiana tabacum] gi|456309|dbj|BAA05648; identical to cDNA NPK1-related protein kinase 1S GI:2342422 Length = 666 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 70 IPSSLRKPAASMIVLQLQSNPARRPSVDKLLQHEF 174 IP +L A ++ LQ P RP+ +LL+H F Sbjct: 296 IPDTLSSDAKDFLLKCLQEVPNLRPTASELLKHPF 330 >At4g22120.1 68417.m03198 early-responsive to dehydration protein-related / ERD protein-related similar to ERD4 protein (early-responsive to dehydration stress) [Arabidopsis thaliana] GI:15375406; contains Pfam profile PF02714: Domain of unknown function DUF221 Length = 771 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -2 Query: 576 VEHDTDALVAELVSESVFVAVVDHLPTHTSGCAAGSLSSSVR 451 V D D V+ELV V DH TH C A L+ V+ Sbjct: 209 VPPDADESVSELVEHFFLVNHPDHYLTHQVVCNANKLADLVK 250 >At3g04530.1 68416.m00480 phosphoenolpyruvate carboxylase kinase 2 (PPCK2) phosphoenolpyruvate carboxylase kinase 2 [Arabidopsis thaliana] gi|13877128|gb|AAK43710; contains protein kinase domain, Pfam:PF00069 Length = 278 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 4/62 (6%) Frame = +1 Query: 1 GKPPFETSTLKDTYKRIKQCEYRIP----SSLRKPAASMIVLQLQSNPARRPSVDKLLQH 168 G+PPF T +D ++ I + R P S+ A ++ + + +RR S + L+H Sbjct: 207 GEPPFNGETAEDIFESILRGNLRFPPKKFGSVSSEAKDLLRKMICRDVSRRFSAEDALRH 266 Query: 169 EF 174 + Sbjct: 267 SW 268 >At2g33550.1 68415.m04112 gt-2-related weak similarity to gt-2 (GI:20249) [Oryza sativa] Length = 314 Score = 27.9 bits (59), Expect = 8.3 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 1/75 (1%) Frame = +1 Query: 22 STLKDTYKRIKQCEYRIPSSLRKPAASMIVLQLQSNPARR-PSVDKLLQHEFFSSGILPA 198 S L YK+IK+ E S +++ S V++ ++ P ++ G++P Sbjct: 101 SNLAGDYKKIKEWE----SQIKEETESYWVMRNDVRREKKLPGFFDKEVYDIVDGGVIPP 156 Query: 199 GLPVSCLTTAPRTDQ 243 +PV L AP +D+ Sbjct: 157 AVPVLSLGLAPASDE 171 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,586,410 Number of Sequences: 28952 Number of extensions: 402135 Number of successful extensions: 1268 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 1224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1263 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -