BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00153 (586 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24C9.07c |bgs2|meu21, pgs2|1,3-beta-glucan synthase subunit ... 26 4.7 SPAC31A2.14 |||WD repeat protein, human WRDR48 family|Schizosacc... 25 6.2 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 25 8.1 >SPAC24C9.07c |bgs2|meu21, pgs2|1,3-beta-glucan synthase subunit Bgs2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1894 Score = 25.8 bits (54), Expect = 4.7 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -1 Query: 478 SNFFLAARCARISAAVICRFSLGGSVGDGLSRGFARRR 365 S F C + +VI S GG+ G RGFA R Sbjct: 1434 SPMFEVFACQTYAQSVIANLSFGGARYIGTGRGFATAR 1471 >SPAC31A2.14 |||WD repeat protein, human WRDR48 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 962 Score = 25.4 bits (53), Expect = 6.2 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 347 ARPNRASGPPEPVLSP 300 +RP+ S PPEP+LSP Sbjct: 574 SRPSPLSLPPEPLLSP 589 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 25.0 bits (52), Expect = 8.1 Identities = 11/32 (34%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 365 GSFPAPA-RPNRASGPPEPVLSPAARRHQVAP 273 G+ +PA +P PP P +PA + H P Sbjct: 716 GAVNSPAIKPQVTPAPPTPAPTPAVKHHPPPP 747 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,274,650 Number of Sequences: 5004 Number of extensions: 45748 Number of successful extensions: 150 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 252150250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -