BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00153 (586 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54131| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_44409| Best HMM Match : PDZ (HMM E-Value=7.1e-33) 39 0.003 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_33275| Best HMM Match : PDZ (HMM E-Value=5.2e-11) 36 0.032 SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) 36 0.032 SB_15888| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.043 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 33 0.13 SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_36084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_403| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_31410| Best HMM Match : PDZ (HMM E-Value=1.1e-15) 33 0.23 SB_26957| Best HMM Match : PDZ (HMM E-Value=0) 33 0.23 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_8332| Best HMM Match : PDZ (HMM E-Value=1.3e-17) 32 0.40 SB_19067| Best HMM Match : PDZ (HMM E-Value=1.6e-12) 31 0.52 SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_12379| Best HMM Match : PDZ (HMM E-Value=4.7e-19) 30 1.6 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_4796| Best HMM Match : Arfaptin (HMM E-Value=3.5e-16) 29 2.1 SB_40268| Best HMM Match : NO_synthase (HMM E-Value=0) 29 2.8 SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) 29 3.7 SB_2072| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_51123| Best HMM Match : PDZ (HMM E-Value=3.8e-18) 28 4.9 SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_25016| Best HMM Match : PDZ (HMM E-Value=5.6e-08) 28 6.4 SB_12386| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) 28 6.4 SB_21416| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_55357| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_52097| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_22475| Best HMM Match : Peptidase_A17 (HMM E-Value=3e-11) 27 8.5 SB_33963| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 27 8.5 >SB_54131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3160 Score = 44.8 bits (101), Expect = 5e-05 Identities = 18/31 (58%), Positives = 26/31 (83%) Frame = +3 Query: 159 VDDGSPAETAGLKRGDRILEVNGHSIAGETH 251 V+DGSPAE AG+++GD IL+VNG+++ G H Sbjct: 2688 VEDGSPAERAGVRKGDFILQVNGNAVKGLPH 2718 Score = 34.7 bits (76), Expect = 0.056 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = +3 Query: 147 VIGKVDDGSPAETAGLKRGDRILEVN 224 V+ +VD+ S AE AGL++GDRIL +N Sbjct: 2582 VVSQVDEWSIAERAGLQKGDRILRLN 2607 >SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2149 Score = 41.1 bits (92), Expect = 6e-04 Identities = 18/34 (52%), Positives = 23/34 (67%) Frame = +3 Query: 150 IGKVDDGSPAETAGLKRGDRILEVNGHSIAGETH 251 + VD GSPA A LK GD ILE+NG ++ +TH Sbjct: 486 VRSVDKGSPAAQARLKPGDHILEINGLNVRNKTH 519 Score = 40.7 bits (91), Expect = 9e-04 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = +3 Query: 159 VDDGSPAETAGLKRGDRILEVNGHSIAGETH 251 VD GSPA A LK GD ILE+NG ++ +TH Sbjct: 321 VDKGSPAAQARLKPGDHILEINGLNVRNKTH 351 Score = 38.7 bits (86), Expect = 0.003 Identities = 21/49 (42%), Positives = 28/49 (57%) Frame = +3 Query: 147 VIGKVDDGSPAETAGLKRGDRILEVNGHSIAGETHKKW*LASRSDLMTP 293 VI V D S AE AGL+ GD+ILE+NG ++ T + L +R P Sbjct: 23 VIISVQDNSIAERAGLQAGDQILELNGENVQALTKDQIVLLARRSTRVP 71 Score = 31.5 bits (68), Expect = 0.52 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +3 Query: 150 IGKVDDGSPAETAGLKRGDRILEVNGHSI 236 + V+ SPA T G++ GD +L+VNG S+ Sbjct: 104 VHNVEPKSPAFTVGMRTGDLVLKVNGVSV 132 >SB_44409| Best HMM Match : PDZ (HMM E-Value=7.1e-33) Length = 718 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/34 (52%), Positives = 22/34 (64%) Frame = +3 Query: 150 IGKVDDGSPAETAGLKRGDRILEVNGHSIAGETH 251 I + GSPAE A L+ GD ILEVNG S+ +H Sbjct: 70 IDSIAQGSPAERANLRIGDEILEVNGTSVENFSH 103 Score = 31.5 bits (68), Expect = 0.52 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +3 Query: 147 VIGKVDDGSPAETAGL-KRGDRILEVNGHSIAGET 248 +IG++ G AE +GL GD ILE+NG + G++ Sbjct: 469 LIGRIVKGGAAEKSGLLHEGDEILEINGVHMKGKS 503 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 37.5 bits (83), Expect = 0.008 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +3 Query: 189 GLKRGDRILEVNGHSIAGETHKK 257 GLKRGD++L VNG S+ GE H+K Sbjct: 575 GLKRGDQLLSVNGVSVEGENHEK 597 >SB_33275| Best HMM Match : PDZ (HMM E-Value=5.2e-11) Length = 881 Score = 35.5 bits (78), Expect = 0.032 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = +3 Query: 171 SPAETAGLKRGDRILEVNGHSIAGETHKK 257 SPA AGLK GD+IL VNG S+ H++ Sbjct: 308 SPAHKAGLKPGDQILYVNGSSVERHPHEQ 336 >SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1772 Score = 35.5 bits (78), Expect = 0.032 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +3 Query: 150 IGKVDDGSPAETAGLKRGDRILEVNGHSIAGETH 251 I VD+ S A AGLK GD+I++VNG S +H Sbjct: 1336 IAGVDEHSAASRAGLKCGDQIMDVNGTSFLNISH 1369 Score = 32.3 bits (70), Expect = 0.30 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 150 IGKVDDGSPAETAGLKRGDRILEVNGHSIAGETH 251 + +D GS +E GL GD IL VN + G TH Sbjct: 1271 VSSIDTGSVSEAIGLLPGDHILAVNDVNFDGLTH 1304 >SB_15888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2437 Score = 35.5 bits (78), Expect = 0.032 Identities = 17/29 (58%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = +3 Query: 174 PAETAG-LKRGDRILEVNGHSIAGETHKK 257 PA+ G ++ GDRILEVNG S+ G THK+ Sbjct: 1291 PADRNGKIRIGDRILEVNGVSLVGVTHKQ 1319 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +3 Query: 150 IGKVDDGSPAETAG-LKRGDRILEVNGHSIAGETHKK 257 I + GS AE G L+ GD+IL+VNG + G +H + Sbjct: 1937 IKTISPGSVAEEDGRLRVGDQILKVNGEDVQGMSHAR 1973 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 150 IGKVDDGSPAETAG-LKRGDRILEVNGHSIAGETHK 254 + V +GS A G LK GDRIL VNG S+ +H+ Sbjct: 998 VKSVTEGSVAFKDGRLKAGDRILAVNGTSLEQVSHE 1033 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 35.1 bits (77), Expect = 0.043 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +3 Query: 159 VDDGSPAETAGLKRGDRILEVNGHSIAGETHKK 257 V DG+ A+ L+ GD +++VNG S+ +TH++ Sbjct: 474 VPDGAAAKDGKLRTGDALIKVNGRSVVNKTHQE 506 Score = 33.1 bits (72), Expect = 0.17 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +3 Query: 144 SVIGKVDDGSPAETAG-LKRGDRILEVNGHSIAGETH 251 S IG++ GSPA+ L GD+++ VNG SI G H Sbjct: 917 STIGRIIQGSPADRCRELYVGDKLVAVNGTSIVGMHH 953 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 156 KVDDGSPAETAG-LKRGDRILEVNGHSIAGETH 251 K+ +G A+ G +K GD +LE+NG S H Sbjct: 1300 KIAEGGVADLDGRIKVGDEVLEINGRSTQHMLH 1332 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 33.5 bits (73), Expect = 0.13 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 150 IGKVDDGSPAETAGLKRGDRILEVNGHSIAGETHKK 257 + KV PA GLK GD+ILEVNG ++ TH + Sbjct: 563 VTKVQPEGPA-AFGLKPGDKILEVNGINLRNTTHDR 597 >SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2749 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +3 Query: 150 IGKVDDGSPAETAG-LKRGDRILEVNGHSIAGETH 251 I + G+PAE G L+ GD++L+VN + G TH Sbjct: 2316 IKDIQPGTPAEKCGHLRTGDQLLQVNDECLVGVTH 2350 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 168 GSPAETAGLKRGDRILEVNGHSIAGETHKK 257 G A+ +++GDR+L VNG S G TH++ Sbjct: 2541 GVAAKDGRIRKGDRVLSVNGRSTKGLTHQE 2570 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 153 GKVDDGSPAETAGLKRGDRILEVNG 227 GK D + + + GL+ GD ILEVNG Sbjct: 46 GKSADQAQSVSGGLRPGDEILEVNG 70 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 171 SPAETAGLKRGDRILEVNGHSIAGETH 251 S + +GL+ GD +LEVNG + G T+ Sbjct: 2701 SASSRSGLEIGDEVLEVNGRHMRGMTN 2727 >SB_36084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 751 Score = 33.5 bits (73), Expect = 0.13 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 150 IGKVDDGSPAETAGLKRGDRILEVNGHSIAGETHKK 257 + +V PA+ AGL GD+I+ VNG+ + T+ + Sbjct: 189 VRQVAPNGPADKAGLSSGDQIVSVNGNQVLNRTYSQ 224 >SB_403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1357 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = +3 Query: 174 PAETAGLKRGDRILEVNGHSIAGETHKK 257 P++ GL+ GD I+ +NG SI G++H++ Sbjct: 549 PSQVGGLEPGDEIVGINGKSIKGKSHEE 576 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 150 IGKVDDGSPAETAG-LKRGDRILEVNGHSIAGETHKK 257 + V GSP+ G L+RGD ++ +NG + TH++ Sbjct: 172 VRNVIPGSPSAEGGVLERGDEVVGINGVNTEDMTHQQ 208 >SB_31410| Best HMM Match : PDZ (HMM E-Value=1.1e-15) Length = 556 Score = 32.7 bits (71), Expect = 0.23 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +3 Query: 150 IGKVDDGSPAETAGLKRGDRILEVNG 227 I +VD S AE GL GD+I+EVNG Sbjct: 157 ISQVDSDSQAEKQGLHLGDQIIEVNG 182 >SB_26957| Best HMM Match : PDZ (HMM E-Value=0) Length = 1685 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = +3 Query: 159 VDDGSPAETAGLKRGDRILEVNGHSIAGETHKK 257 +++ S A LK GD+ILEV+GH + +H++ Sbjct: 1326 LENSSVARLGELKAGDQILEVDGHDLRNASHEE 1358 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 32.3 bits (70), Expect = 0.30 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 150 IGKVDDGSPAETAGLKRGDRILEVNGHSIAGETH 251 IG+V+ G A+ G+K D ILEV G + TH Sbjct: 719 IGEVERGGEADRKGVKCKDFILEVEGEDVTTATH 752 >SB_8332| Best HMM Match : PDZ (HMM E-Value=1.3e-17) Length = 1038 Score = 31.9 bits (69), Expect = 0.40 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +3 Query: 201 GDRILEVNGHSIAGETH 251 GD +LEVNGH ++G TH Sbjct: 167 GDELLEVNGHKLSGRTH 183 >SB_19067| Best HMM Match : PDZ (HMM E-Value=1.6e-12) Length = 217 Score = 31.5 bits (68), Expect = 0.52 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +3 Query: 159 VDDGSPAETAGLKRGDRILEVNGHSIAG 242 V SPA GL+ GD+IL+++G ++AG Sbjct: 71 VHKDSPAALGGLRFGDQILQIDGENMAG 98 >SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1501 Score = 31.1 bits (67), Expect = 0.69 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +3 Query: 159 VDDGSPAETAGLKRGDRILEVNGHSIAGETHKK 257 V DG A+ L+ GD+++ VNG S+ G + +K Sbjct: 1013 VKDGPAAKDGRLQAGDQLIAVNGESLIGVSQEK 1045 >SB_12379| Best HMM Match : PDZ (HMM E-Value=4.7e-19) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 150 IGKVDDGSPAETAGLKRGDRILEVN 224 + V +G+PA GL+RGD+IL N Sbjct: 57 VAGVREGNPAHRQGLRRGDKILMAN 81 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 150 IGKVDDGSPAETAGLKRGDRILEVN 224 + V +G+PA GL+RGD+IL N Sbjct: 948 VAGVREGNPAHRQGLRRGDKILMAN 972 >SB_4796| Best HMM Match : Arfaptin (HMM E-Value=3.5e-16) Length = 270 Score = 29.5 bits (63), Expect = 2.1 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 156 KVDDGSPAETAG-LKRGDRILEVNGHSIAGET 248 +V D +PA G L+ GD I+ VNG S+ G+T Sbjct: 48 QVFDNTPASKDGTLQAGDEIVGVNGKSLRGKT 79 >SB_40268| Best HMM Match : NO_synthase (HMM E-Value=0) Length = 465 Score = 29.1 bits (62), Expect = 2.8 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +3 Query: 150 IGKVDDGSPAE-TAGLKRGDRILEVNGHSIAGETHKK 257 I + GS AE + L+ GD ILEVNG SI E+H K Sbjct: 33 ISDIVKGSAAEGVSNLQPGDIILEVNGKSIE-ESHFK 68 >SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -3 Query: 356 PAPARPNRASGP-PEPVLSPAARRHQVAP 273 PAPAR ASGP P+P + P R P Sbjct: 222 PAPARDRAASGPGPKPAVKPRDRLATAPP 250 >SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -3 Query: 563 DAHCTLITHHHSFFTMSN*PKVH--RHFLRVELLLGGEMCSHLG 438 + H HH S T+ + ++ RH+L +E + GG++ H G Sbjct: 57 EGHIVASLHHPSIITIYDIDQLADGRHYLTMEFVPGGDLAQHKG 100 >SB_2072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 28.7 bits (61), Expect = 3.7 Identities = 16/61 (26%), Positives = 24/61 (39%) Frame = +3 Query: 336 IWTCRCRKRPLRLANPRDSPSPTEPPKLNLQMTAAEMRAHLAAKKKFDPKKVPMDLRSV* 515 +W C P+ + P DSP PP L R +A K +PK+ + + Sbjct: 289 LWQYECSDDPVDIELPPDSPET--PPNLPQPPKRRSRRLQVATGLKLNPKRPELSRNTAE 346 Query: 516 H 518 H Sbjct: 347 H 347 >SB_51123| Best HMM Match : PDZ (HMM E-Value=3.8e-18) Length = 182 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 162 DDGSPAETAGLKRGDRILEVNGHSIAGETH 251 +DG+ A+ L GD+ILEVN + TH Sbjct: 61 EDGAAAKDGRLWAGDQILEVNNCDLREATH 90 >SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2179 Score = 28.3 bits (60), Expect = 4.9 Identities = 23/58 (39%), Positives = 27/58 (46%) Frame = +3 Query: 354 RKRPLRLANPRDSPSPTEPPKLNLQMTAAEMRAHLAAKKKFDPKKVPMDLRSV*HREE 527 RKR LR P S P PPKL +++ E + KKK KK D R REE Sbjct: 1156 RKRLLRKLKPNGSTLPELPPKLCIKLKVKEKK-----KKK---KKKGSDERETLMREE 1205 >SB_25016| Best HMM Match : PDZ (HMM E-Value=5.6e-08) Length = 816 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 165 DGSPAETAG-LKRGDRILEVNGHSIAGETHKK 257 DGS A L+RGD+++ V G ++ G TH++ Sbjct: 125 DGSDAYRDNRLRRGDQLVTVAGETLVGVTHEQ 156 >SB_12386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 530 Score = 27.9 bits (59), Expect = 6.4 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 159 VDDGSPAETAGLKRGDRILEVNGHSIAGETHK 254 V++ PA AG++ GD I+ V + E H+ Sbjct: 425 VEEDGPAYMAGMRPGDIIVSVENRDVEEEDHR 456 >SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) Length = 549 Score = 27.9 bits (59), Expect = 6.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 192 LKRGDRILEVNGHSIAGETHKK 257 L+ GD +LE NG S+ G T+ K Sbjct: 270 LQEGDHLLEANGESMVGVTNDK 291 >SB_21416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 27.9 bits (59), Expect = 6.4 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 150 IGKVDDGSPAETAGLKR-GDRILEVNGHSIAGET 248 I ++ G AE+ GL D +LEVNG ++G+T Sbjct: 198 ISRLVPGGLAESTGLLAVNDEVLEVNGIDVSGKT 231 >SB_55357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 345 CRCRKRPLRLANPRDSPSPTEPP 413 C RK+ ++L P P PT+PP Sbjct: 31 CVIRKKTIKLKEPLPLPMPTKPP 53 >SB_52097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 27.5 bits (58), Expect = 8.5 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 4/73 (5%) Frame = -3 Query: 431 HLQVQLRRFGRRRT--VPGVR*AEGSFPAPARPNRASGPPE--PVLSPAARRHQVAP*CE 264 HL ++ ++ GR+R + G+ A G+ P + +G P P+LS R Q+AP C Sbjct: 306 HLGLEKKKRGRKRRSELMGIPGANGA-PLIKKVMTDNGIPVAGPLLSSVVRPRQLAPACN 364 Query: 263 LPLLVGLAGDTMT 225 L +A MT Sbjct: 365 LQQNGSVARPAMT 377 >SB_22475| Best HMM Match : Peptidase_A17 (HMM E-Value=3e-11) Length = 646 Score = 27.5 bits (58), Expect = 8.5 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = -3 Query: 521 TMSN*PKVHRHFLRVELLLGGEMCSHLGRGHLQVQLRRFGRRRTVPGVR*AEGSF 357 TM P LR+ ++ + S LG G + V L+RF RT+P + A +F Sbjct: 12 TMKTSPSAWSVGLRLTIVSLFLVISVLGNGSILVLLKRFKSLRTIPNILIANLAF 66 >SB_33963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 726 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 171 SPAETAGLKRGDRILEVNGHSI 236 SPA+ AGL +GD ++ V+G I Sbjct: 241 SPADLAGLHKGDVLIAVDGQKI 262 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 Query: 353 APARPNRASGPPEPVLSPAAR 291 AP P++A PP P SPA R Sbjct: 116 APETPSQAPSPPPPPTSPATR 136 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,993,433 Number of Sequences: 59808 Number of extensions: 416072 Number of successful extensions: 1647 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 1485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1646 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -