BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00152 (787 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 28 0.074 AY563109-1|AAS99587.1| 46|Tribolium castaneum aristaless protein. 22 6.4 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 28.3 bits (60), Expect = 0.074 Identities = 18/54 (33%), Positives = 27/54 (50%) Frame = +3 Query: 510 YLF**NRLSRND*KA*ALRTHRNESLFSNDNTNK*KMLTKNLQSHINILNISGQ 671 +LF R +R+D LRTH E F+ NK M + +L H+ N +G+ Sbjct: 349 WLFCGKRFTRSDELQRHLRTHTGEKRFACPICNKRFMRSDHLAKHVKTHNGNGK 402 >AY563109-1|AAS99587.1| 46|Tribolium castaneum aristaless protein. Length = 46 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 105 KNLMDVFSRLGYPSASSHEELRSK 176 + L FSR YP + EEL K Sbjct: 10 EELEKAFSRTHYPDVFTREELAMK 33 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,849 Number of Sequences: 336 Number of extensions: 3316 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21272645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -