BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00152 (787 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10347| Best HMM Match : DUF1497 (HMM E-Value=2.1) 29 4.3 SB_14937| Best HMM Match : DUF1497 (HMM E-Value=1) 28 7.5 >SB_10347| Best HMM Match : DUF1497 (HMM E-Value=2.1) Length = 113 Score = 29.1 bits (62), Expect = 4.3 Identities = 21/95 (22%), Positives = 39/95 (41%), Gaps = 1/95 (1%) Frame = +3 Query: 30 MNNKKICYFLYVITKLKSYTVCITNKNLMDVFSRLGYPSASSHEELRSK-NYFRYLNRVN 206 M N Y + L S C ++ + ++ +R HE + + NYF N Sbjct: 1 MANPSFANLPYWASNLSSVVDCKAHRIIREIGARWQKGELVEHEAINAMCNYFATENETL 60 Query: 207 LIEVQLLMLIPNKMNLNYKDKCRVLSGILLKLNSL 311 V +L I + L +++CR + + +LN + Sbjct: 61 RYRVIMLNEILGEKELQIENQCRDIEELKWELNKI 95 >SB_14937| Best HMM Match : DUF1497 (HMM E-Value=1) Length = 113 Score = 28.3 bits (60), Expect = 7.5 Identities = 21/95 (22%), Positives = 39/95 (41%), Gaps = 1/95 (1%) Frame = +3 Query: 30 MNNKKICYFLYVITKLKSYTVCITNKNLMDVFSRLGYPSASSHEELRSK-NYFRYLNRVN 206 M N Y + L S C + + ++ +R HE + + NYF N Sbjct: 1 MANPSFANLPYWASNLSSVVDCKAHHIIREIGARWQKGELVEHEAINAMCNYFATENETL 60 Query: 207 LIEVQLLMLIPNKMNLNYKDKCRVLSGILLKLNSL 311 +V +L I + L +++CR + + +LN + Sbjct: 61 RYKVIMLNEILGEKELQIENQCRDIEELKWELNKI 95 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,714,440 Number of Sequences: 59808 Number of extensions: 353660 Number of successful extensions: 721 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -