BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00145 (656 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC8D2.01 |gsk31||serine/threonine protein kinase Gsk31|Schizos... 29 0.59 SPAC144.09c |sfc2||RNA polymerase III transcription factor TFIII... 27 2.4 SPCC1529.01 ||SPCC794.14|membrane transporter|Schizosaccharomyce... 27 3.1 SPBC4B4.03 |rsc1||RSC complex subunit Rsc1 |Schizosaccharomyces ... 26 5.5 SPAC140.01 |sdh2||succinate dehydrogenase |Schizosaccharomyces p... 25 9.6 >SPBC8D2.01 |gsk31||serine/threonine protein kinase Gsk31|Schizosaccharomyces pombe|chr 2|||Manual Length = 381 Score = 29.1 bits (62), Expect = 0.59 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -2 Query: 319 DVFCYTLYKYNIWNSLIYSFYTFVISR-LNYYHGTGADFLNIKQQSMGESYSTG 161 D+ YT + +I N L Y F + R L Y H TG +IK Q++ Y TG Sbjct: 111 DMRWYTRRRKSIPN-LSIKLYAFQLFRALAYLHSTGVCHRDIKPQNLLVDYKTG 163 >SPAC144.09c |sfc2||RNA polymerase III transcription factor TFIIIA|Schizosaccharomyces pombe|chr 1|||Manual Length = 374 Score = 27.1 bits (57), Expect = 2.4 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +1 Query: 217 LSHDNNLSVKLQRYRKNKSRNSRYCTYTVCSKKHQQ 324 + H N LS++++ ++ +C Y C KK+ + Sbjct: 1 MCHFNELSIEIESKNLRSAKKIFHCPYEECGKKYSR 36 >SPCC1529.01 ||SPCC794.14|membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 462 Score = 26.6 bits (56), Expect = 3.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 307 YTLYKYNIWNSLIYSFYTFVIS 242 YT YK+ W++ I+S + F +S Sbjct: 197 YTTYKWIFWSTTIFSGFIFALS 218 >SPBC4B4.03 |rsc1||RSC complex subunit Rsc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 803 Score = 25.8 bits (54), Expect = 5.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 297 YSV*QKTSAVCLERLRTFAARGAVP 371 YS Q C+++LRTF +G +P Sbjct: 100 YSFVQALEEFCIQQLRTFQQQGYIP 124 >SPAC140.01 |sdh2||succinate dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 252 Score = 25.0 bits (52), Expect = 9.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 164 GLPGSCALNITTSSGCYCGC 105 G+ GSCA+NI S+ C C Sbjct: 78 GICGSCAMNINGSNTLACIC 97 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,369,878 Number of Sequences: 5004 Number of extensions: 44189 Number of successful extensions: 88 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -