BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00145 (656 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF053067-1|AAC35273.1| 405|Caenorhabditis elegans cyclin D prot... 27 8.9 AF016668-4|AAO12440.1| 222|Caenorhabditis elegans Hypothetical ... 27 8.9 >AF053067-1|AAC35273.1| 405|Caenorhabditis elegans cyclin D protein. Length = 405 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = -2 Query: 319 DVFCYTLYKYNIWNSLIYSFYTFVISRLNYYHGTGADFLNIKQQ 188 ++ T ++ + +SF+ F+ SR+ H T DF + Q+ Sbjct: 189 ELLIVTTLQWETESPTAFSFFNFLASRIPQIHNTRGDFQTVVQK 232 >AF016668-4|AAO12440.1| 222|Caenorhabditis elegans Hypothetical protein F36H9.4 protein. Length = 222 Score = 27.5 bits (58), Expect = 8.9 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 97 LQCVANVC*CPDGWLSSYNPK 35 +QC+ NVC C DG+ + + K Sbjct: 51 MQCIVNVCQCKDGFFRNKDKK 71 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,042,188 Number of Sequences: 27780 Number of extensions: 251695 Number of successful extensions: 657 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1465835342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -