BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00143 (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 25 2.5 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 25 3.3 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 25 3.3 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 24 4.3 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 24 4.3 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 4.3 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 4.3 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 24 4.3 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 24 4.3 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 24 4.3 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 24 4.3 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 24 4.3 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 24 5.7 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 24 5.7 AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like pepti... 24 5.7 AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like pepti... 24 5.7 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 24 5.7 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 82 SSPKKHRST*TAHHSQILN*LAAPLSYH 165 ++P H S AHH+ + AAP+++H Sbjct: 181 AAPIAHYSAPIAHHAAPITHYAAPIAHH 208 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 24.6 bits (51), Expect = 3.3 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +3 Query: 423 SSRYVTGQTVTVSTRKTTY-LRXXXXXXXXXRCEGCTYCS 539 +SRY T T+ +S K TY LR C YCS Sbjct: 458 ASRYGTSDTMQMSGMKVTYDLRRPAGSRVVSVSLRCRYCS 497 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 24.6 bits (51), Expect = 3.3 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +3 Query: 423 SSRYVTGQTVTVSTRKTTY-LRXXXXXXXXXRCEGCTYCS 539 +SRY T T+ +S K TY LR C YCS Sbjct: 458 ASRYGTSDTMQMSGMKVTYDLRRPAGSRVVSVSLRCRYCS 497 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 4 VLCLFSPWSQLCL 42 VLCL PW+ +CL Sbjct: 251 VLCLLVPWTCICL 263 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 4 VLCLFSPWSQLCL 42 VLCL PW+ +CL Sbjct: 251 VLCLLVPWTCICL 263 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 82 SSPKKHRST*TAHHSQILN*LAAPLSYH 165 ++P H S AHH+ + AAP+++H Sbjct: 181 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 208 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 82 SSPKKHRST*TAHHSQILN*LAAPLSYH 165 ++P H S AHH+ + AAP+++H Sbjct: 177 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 204 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 82 SSPKKHRST*TAHHSQILN*LAAPLSYH 165 ++P H S AHH+ + AAP+++H Sbjct: 189 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 216 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 82 SSPKKHRST*TAHHSQILN*LAAPLSYH 165 ++P H S AHH+ + AAP+++H Sbjct: 189 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 216 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 82 SSPKKHRST*TAHHSQILN*LAAPLSYH 165 ++P H S AHH+ + AAP+++H Sbjct: 213 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 240 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 82 SSPKKHRST*TAHHSQILN*LAAPLSYH 165 ++P H S AHH+ + AAP+++H Sbjct: 181 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 208 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 82 SSPKKHRST*TAHHSQILN*LAAPLSYH 165 ++P H S AHH+ + AAP+++H Sbjct: 189 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 216 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.8 bits (49), Expect = 5.7 Identities = 17/54 (31%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = +3 Query: 87 PEEAQKYLNSPPFTDPQLAGRTAVLP---LIKYNDPRFRTVEAGPTLGHYWKNG 239 P +AQ L SP + G V Y+ FR + G L H+W NG Sbjct: 366 PSDAQGNLLSPIINPDKTCGGGWVCEHRWRQMYSMIHFRNLAWGTPLRHWWDNG 419 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 363 IASDPETSPARISTRTA 413 +A+ P TS AR +TRTA Sbjct: 565 VATPPSTSRARTATRTA 581 >AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 23.8 bits (49), Expect = 5.7 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -3 Query: 107 VLLCFFGLDVNLENIDAGFRRRRHNC 30 VLL G+D +L+ +++ +R+ H C Sbjct: 24 VLLSVSGVDGSLQYVESNSQRKAHYC 49 >AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 23.8 bits (49), Expect = 5.7 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -3 Query: 107 VLLCFFGLDVNLENIDAGFRRRRHNC 30 VLL G+D +L+ +++ +R+ H C Sbjct: 24 VLLSVSGVDGSLQYVESNSQRKAHYC 49 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 23.8 bits (49), Expect = 5.7 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -3 Query: 107 VLLCFFGLDVNLENIDAGFRRRRHNC 30 VLL G+D +L+ +++ +R+ H C Sbjct: 24 VLLSVSGVDGSLQYVESNSQRKAHYC 49 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 740,452 Number of Sequences: 2352 Number of extensions: 14935 Number of successful extensions: 66 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -