BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00143 (748 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT007225-1|AAP35889.1| 382|Homo sapiens protein kinase, cAMP-de... 32 1.9 BC002763-1|AAH02763.1| 382|Homo sapiens PRKAR2A protein protein. 32 1.9 >BT007225-1|AAP35889.1| 382|Homo sapiens protein kinase, cAMP-dependent, regulatory, type II, alpha protein. Length = 382 Score = 32.3 bits (70), Expect = 1.9 Identities = 16/42 (38%), Positives = 27/42 (64%) Frame = +2 Query: 344 ESAKVENRVRSGDVTGSYIYKDGKNDLVKVRYWSDRDGFHQE 469 +S +V R++ DV G IYKDG+ + + + S++DG +QE Sbjct: 263 KSLEVSERMKIVDVIGEKIYKDGERIITQTK--SNKDGGNQE 302 >BC002763-1|AAH02763.1| 382|Homo sapiens PRKAR2A protein protein. Length = 382 Score = 32.3 bits (70), Expect = 1.9 Identities = 16/42 (38%), Positives = 27/42 (64%) Frame = +2 Query: 344 ESAKVENRVRSGDVTGSYIYKDGKNDLVKVRYWSDRDGFHQE 469 +S +V R++ DV G IYKDG+ + + + S++DG +QE Sbjct: 263 KSLEVSERMKIVDVIGEKIYKDGERIITQTK--SNKDGGNQE 302 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,410,071 Number of Sequences: 237096 Number of extensions: 2175703 Number of successful extensions: 4898 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4898 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8959138240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -