BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00142 (754 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.3 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 23 3.1 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 3.1 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 9.4 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -2 Query: 285 SQAIVFHCKFEERLPKTFPLSWLEVIPLVNST 190 S++ + H + E RL P WL ++P ++ + Sbjct: 366 SESFMKHYENEMRLRNGCPADWLWIVPPISGS 397 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 376 GTFAPQTGTKTGKLKTSFTNDTVAVNTNL 462 GT Q TG +F NDTV+ T + Sbjct: 86 GTSESQWEDVTGSTPLTFVNDTVSFTTTV 114 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +2 Query: 155 FKLDLKTKSESGVEFTSGITSNQ 223 F+LDL+ + E+G + +S IT+ + Sbjct: 174 FQLDLQLQDEAGGDISSFITNGE 196 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 31 GILCEIIPICEFI 69 GI CEI CEF+ Sbjct: 59 GIKCEIYAKCEFL 71 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,974 Number of Sequences: 438 Number of extensions: 4365 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -