BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00141 (627 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |S... 28 0.96 SPAPB1A11.04c |||transcription factor |Schizosaccharomyces pombe... 26 3.9 >SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 971 Score = 28.3 bits (60), Expect = 0.96 Identities = 13/58 (22%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = -3 Query: 238 YNWHDCFVCKYI*IHINLYVFYIKCTYLKKILIR---LSVCLETYTLYPLTHLMCTHE 74 ++WHD F+ Y+ + ++ KC+ + + R + L T++PL + H+ Sbjct: 127 HDWHDIFMIGYLISNAPWFILVSKCSPVNSMASRIRNIGSALFVLTIFPLIYWYIQHK 184 >SPAPB1A11.04c |||transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 697 Score = 26.2 bits (55), Expect = 3.9 Identities = 8/24 (33%), Positives = 17/24 (70%) Frame = -1 Query: 435 SIHVLIKYCTKCFELNFVSGLRVI 364 +IH+L+K+C + N++S R++ Sbjct: 515 TIHMLLKFCVVNIDQNYISSSRLV 538 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,535,028 Number of Sequences: 5004 Number of extensions: 54746 Number of successful extensions: 130 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -