BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00141 (627 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0035 - 9945522-9945557,9946413-9946598,9948217-9948313,994... 29 3.0 01_07_0093 + 41045841-41045968,41046068-41046161,41046740-410469... 28 5.3 >04_03_0035 - 9945522-9945557,9946413-9946598,9948217-9948313, 9948789-9949114 Length = 214 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 169 LYKTHINLYVFIYIYTQNNRANYIVQ 246 L+ H+ ++ IYIY N R +YIV+ Sbjct: 102 LWSPHVRRFINIYIYVGNARKSYIVK 127 >01_07_0093 + 41045841-41045968,41046068-41046161,41046740-41046925, 41047035-41047082,41047158-41047343,41047430-41047516, 41048059-41048145,41048231-41048317 Length = 300 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = -3 Query: 193 INLYVFYIKCTYLKKILIRLSVCLETYTLYPLTHLMCTHENALAH 59 +N Y+ Y C Y + + + C E Y Y TH C L H Sbjct: 35 VNEYMNYYDCAY-RMAVQKDQYCQEMYNSYKATHESCVCAMVLPH 78 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,464,334 Number of Sequences: 37544 Number of extensions: 246174 Number of successful extensions: 392 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -