BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00140 (707 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0202 - 15544498-15545037,15546043-15546449,15546874-155469... 35 0.055 08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,366... 31 0.90 06_01_0605 + 4373697-4373872,4374840-4374876,4375296-4375399,437... 29 2.7 04_04_0190 - 23442824-23442846,23442891-23442949,23443613-234437... 29 2.7 06_03_0095 - 16575938-16576585,16577028-16577219,16577294-165773... 29 3.6 01_03_0206 - 13783169-13783651,13783761-13783903,13783962-137841... 29 4.8 12_01_0378 - 2946916-2947590 28 6.3 >09_04_0202 - 15544498-15545037,15546043-15546449,15546874-15546977, 15547580-15547788,15548092-15549428,15551680-15551941 Length = 952 Score = 35.1 bits (77), Expect = 0.055 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +2 Query: 455 WKLIALWENNKVYFKILNLNVTNTWYWESALTGTATIWPSEST 583 WK I W + LNL + T Y +S L IWP +ST Sbjct: 403 WKDIGFWNEGNGILRQLNLGKSTTKYADSVLDLNPVIWPGKST 445 >08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870, 3661975-3662133,3662193-3662243,3662838-3663018, 3663102-3663228,3663322-3663431,3663529-3663667, 3663767-3663876,3664002-3664071,3664247-3664320, 3664458-3664553,3664682-3664777,3665041-3665168, 3665422-3665656,3665743-3665910,3666274-3666381, 3666468-3666617,3666905-3667015,3667118-3667297, 3667427-3667555,3667819-3667914,3668108-3668293, 3668431-3668603,3668720-3668921 Length = 1150 Score = 31.1 bits (67), Expect = 0.90 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 287 RCPWSPGAKVDGVLHAVHLVVSYQFV 210 RC WSP + GV + H+V +Y FV Sbjct: 430 RCLWSPDGSILGVAFSKHIVQTYAFV 455 >06_01_0605 + 4373697-4373872,4374840-4374876,4375296-4375399, 4375942-4376137,4376385-4376451,4376895-4376998, 4377090-4377174,4377309-4377369,4377694-4377825, 4377924-4377993,4379261-4379413,4379583-4379694, 4379779-4379920,4380023-4380140,4380862-4380957, 4381061-4381189 Length = 593 Score = 29.5 bits (63), Expect = 2.7 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 186 SEVITNVVNKLIRNN--KMNCMEYAINFGSRAPRTSSGIVSQLSSDLSSPKTRLSLCTS 356 SE I+++ N+L R+ K+ C N S A I S+L S LS+ TRL CTS Sbjct: 343 SEFISHLANQLARHQFLKIACQLERKNIAS-AYSLLRVIESELQSYLSAVNTRLGHCTS 400 >04_04_0190 - 23442824-23442846,23442891-23442949,23443613-23443737, 23443767-23443901,23444195-23444301,23444488-23444566, 23444856-23444942,23445045-23445281,23445783-23446128, 23446486-23446694 Length = 468 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 311 TQLGNNPGRCPWSPGAKVDGVLHAVHLVVSYQF 213 T G P CP S AKV+ HLV++Y++ Sbjct: 411 TPFGGGPRLCPGSELAKVEAAFFLHHLVLNYRW 443 >06_03_0095 - 16575938-16576585,16577028-16577219,16577294-16577392, 16577496-16577618,16577717-16577929,16578143-16578251, 16578339-16578427,16578604-16578880,16578974-16579084, 16579160-16580508,16581218-16581631 Length = 1207 Score = 29.1 bits (62), Expect = 3.6 Identities = 23/74 (31%), Positives = 35/74 (47%) Frame = -2 Query: 397 ALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPDDVLGALEPKLMAYSMQFILLFRI 218 +L +IA S + K + + GE K W PDD +PK A + F LL + Sbjct: 316 SLLVIALLGSVLFGIWTKEDLMNGEMK---RWYLRPDDSTIFYDPKRAALASFFHLLTAL 372 Query: 217 SLFTTFVMTSLFFS 176 L++ F+ SL+ S Sbjct: 373 MLYSYFIPISLYIS 386 >01_03_0206 - 13783169-13783651,13783761-13783903,13783962-13784128, 13784641-13785149,13786031-13786312,13786397-13786792, 13787232-13787504 Length = 750 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +2 Query: 452 SWKLIALWENNKVYFKILNLNVTNTWYWESALTGTATIWPSESTASIV 595 SW IA + V + N ++ N W+W + GTAT + + +V Sbjct: 516 SWSYIA--NASSVGYAPGNFSMQNNWFWFEKVVGTATPEKDQQDSKVV 561 >12_01_0378 - 2946916-2947590 Length = 224 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +3 Query: 3 GLDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYD 143 G+ ++P +++L ASL AA++ VP + ++ +VV D+D Sbjct: 87 GVHYDAIRPRLLLLLAGGASLGAANATVPGVFHQPRMSTTVVAIDFD 133 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,637,425 Number of Sequences: 37544 Number of extensions: 313091 Number of successful extensions: 995 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 995 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -