BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00140 (707 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 25 0.93 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 25 0.93 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 25 0.93 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 25 0.93 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.93 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 23 2.1 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 23 2.1 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 23 2.1 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.1 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 5.0 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 6.6 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 8.7 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 8.7 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 8.7 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 8.7 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 8.7 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 24.6 bits (51), Expect = 0.93 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -2 Query: 460 LPADSRACLVLAVAVGRSAIVALNIIAQRQSETVALVHKLNRVF 329 LP DS L L V + S V LN++A+ T V + F Sbjct: 218 LPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGSYF 261 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 24.6 bits (51), Expect = 0.93 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -2 Query: 460 LPADSRACLVLAVAVGRSAIVALNIIAQRQSETVALVHKLNRVF 329 LP DS L L V + S V LN++A+ T V + F Sbjct: 218 LPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGSYF 261 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 24.6 bits (51), Expect = 0.93 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -2 Query: 460 LPADSRACLVLAVAVGRSAIVALNIIAQRQSETVALVHKLNRVF 329 LP DS L L V + S V LN++A+ T V + F Sbjct: 218 LPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGSYF 261 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 24.6 bits (51), Expect = 0.93 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -2 Query: 460 LPADSRACLVLAVAVGRSAIVALNIIAQRQSETVALVHKLNRVF 329 LP DS L L V + S V LN++A+ T V + F Sbjct: 286 LPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGSYF 329 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 24.6 bits (51), Expect = 0.93 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +1 Query: 427 QGQDKPESQLEVNRSVGEQQGLLQDLEPERNQYLVLGVGTNWNGDHMAFGV 579 Q DK ++ + + +QQ L+Q L+ ++QYL L G G + + G+ Sbjct: 165 QTADKKKASAPLQQLALQQQRLIQQLQITQSQYL-LQQGLGLQGHNPSSGL 214 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 460 LPADSRACLVLAVAVGRSAIVALNIIAQ 377 LP DS L L V + S V LN++A+ Sbjct: 218 LPPDSGEKLTLGVTILLSLTVFLNLVAE 245 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 460 LPADSRACLVLAVAVGRSAIVALNIIAQ 377 LP DS L L V + S V LN++A+ Sbjct: 218 LPPDSGEKLTLGVTILLSLTVFLNLVAE 245 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 460 LPADSRACLVLAVAVGRSAIVALNIIAQ 377 LP DS L L V + S V LN++A+ Sbjct: 218 LPPDSGEKLTLGVTILLSLTVFLNLVAE 245 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 460 LPADSRACLVLAVAVGRSAIVALNIIAQ 377 LP DS L L V + S V LN++A+ Sbjct: 286 LPPDSGEKLTLGVTILLSLTVFLNLVAE 313 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +2 Query: 176 GEEERSHHKCREQTDTKQQDELHGVRHQ 259 GE S + RE ++ D+LH V + Sbjct: 249 GERSCSRDRSREYKKDRRYDQLHNVEEK 276 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.8 bits (44), Expect = 6.6 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +2 Query: 317 LIFAENAIKLMYKRDGLALTLSNDVQGDDGRPAYGDGKDKTSPRVS 454 L E IK+ ++ + N +G P GDG + SP+ S Sbjct: 307 LCLTERQIKIWFQNRRMKWKKENKSKGT---PGSGDGDTEISPQTS 349 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 84 VPNDILEEQLYNSVVVADYDSAVEK 158 VP+++ + LYN +VV++ S K Sbjct: 566 VPDEVPSDVLYNRLVVSEDGSETFK 590 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 84 VPNDILEEQLYNSVVVADYDSAVEK 158 VP+++ + LYN +VV++ S K Sbjct: 566 VPDEVPSDVLYNRLVVSEDGSETFK 590 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 8.7 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -3 Query: 618 LQVPLGSETIDAVDSEGHMVAVPVSADSQYQVLVT 514 L+ P+G+E+ V S G + + D + Q+L+T Sbjct: 38 LERPVGNESEPLVLSFGLTLMQIIDVDEKNQLLIT 72 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 179 EEERSHHKCREQTDTKQQDELH 244 +EER K R+Q++ + LH Sbjct: 181 QEERQRTKERDQSEVESTSSLH 202 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 179 EEERSHHKCREQTDTKQQDELH 244 +EER K R+Q++ + LH Sbjct: 181 QEERQRTKERDQSEVESTSSLH 202 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,545 Number of Sequences: 438 Number of extensions: 3377 Number of successful extensions: 20 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -