BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00135 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0724 - 35757228-35757323,35757837-35757893,35757983-357580... 50 2e-06 06_01_0082 + 656362-657798 32 0.38 05_02_0135 - 6965294-6965875 32 0.38 05_04_0148 - 18426903-18427106,18430516-18430594,18430752-184309... 31 0.67 11_06_0289 - 21969248-21973516 30 2.0 02_01_0625 + 4690607-4690696,4692673-4692734,4692867-4693230 30 2.0 11_06_0284 + 21909758-21913645 29 2.7 03_04_0130 + 17543991-17545758,17545889-17545971,17546396-17546467 29 2.7 01_01_0231 + 1951047-1951499 29 2.7 01_01_0230 - 1946079-1946786,1946981-1947141,1948010-1948457 29 2.7 01_01_0229 - 1943473-1943922 29 2.7 04_04_1098 + 30876785-30876835,30876846-30877171,30877396-308774... 29 3.5 03_02_0619 + 9904405-9904586,9905315-9906764,9907320-9907509,990... 29 3.5 03_01_0617 + 4532651-4532893,4534713-4534939,4535077-4535150,453... 29 4.7 11_01_0678 - 5534879-5534883,5535430-5535529,5535638-5535799,553... 28 6.2 10_01_0209 + 2236530-2237301,2239196-2239297,2239535-2239716,224... 28 6.2 08_01_0618 - 5394841-5395036,5395179-5395244,5395727-5395769,539... 28 6.2 04_04_0877 + 29018168-29018279,29019013-29019230,29019333-29019713 28 6.2 01_01_0420 + 3175544-3176696,3177035-3178581,3179623-3179688,317... 28 6.2 11_06_0185 + 21018045-21022307 28 8.2 08_01_0626 - 5445676-5446687,5447099-5447430 28 8.2 07_03_1762 - 29299328-29299437,29299782-29299871,29300487-293012... 28 8.2 07_01_0566 + 4207894-4207974,4208090-4208144,4208671-4208759,420... 28 8.2 03_05_0483 - 24806984-24808324 28 8.2 02_05_0958 + 33073302-33073442,33073839-33073913,33074382-330744... 28 8.2 01_01_0272 - 2249662-2249721,2250110-2250335,2250419-2250615,225... 28 8.2 >03_06_0724 - 35757228-35757323,35757837-35757893,35757983-35758075, 35758271-35758336,35758444-35758653,35758750-35759022, 35759112-35759251,35759330-35759471 Length = 358 Score = 50.0 bits (114), Expect = 2e-06 Identities = 29/81 (35%), Positives = 38/81 (46%) Frame = +1 Query: 16 KNKEIDTNSERTKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSDFHGIKQLLRQ 195 K E ++ ER D DSD DSD +QADF +P+ DFHG+K LL+ Sbjct: 63 KRAEPSSDEERYSSDDESYSSDSD-DSDDASEELDTVQADFAFYDPKPGDFHGVKLLLKT 121 Query: 196 LFLKSNVDLGGLAQIIISQNT 258 DL G +I+ Q T Sbjct: 122 YLDSKPWDLTGFVDLILEQTT 142 >06_01_0082 + 656362-657798 Length = 478 Score = 32.3 bits (70), Expect = 0.38 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = +1 Query: 22 KEIDTNSERTKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSDFH 171 K NS R E D D D D +G E++ D E + EDSDF+ Sbjct: 223 KRATNNSSRLDEDDDDDNDDDDDDDEGE---EQQQNNDSEMMDVEDSDFY 269 >05_02_0135 - 6965294-6965875 Length = 193 Score = 32.3 bits (70), Expect = 0.38 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +1 Query: 19 NKEIDTNSERTKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 165 + + D +S+ + DS S+ DSDFD + + + D +G + +D D Sbjct: 110 DSDSDHDSDSDHDHDSDSDHDSDFDRGSDSDHDSDSNHDIDGDDNDDDD 158 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +1 Query: 22 KEIDTNSERTKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 165 K++D + + + DS + DSD DSD ++ + + D + DSD Sbjct: 93 KKLDNDDDDGSDWDSVDDSDSDHDSDSDHDHDSDSDHDSDFDRGSDSD 140 >05_04_0148 - 18426903-18427106,18430516-18430594,18430752-18430935, 18431020-18431063,18432028-18432165,18432713-18434511 Length = 815 Score = 31.5 bits (68), Expect = 0.67 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = -1 Query: 466 IYLINSLVLG-SAFS*DSFVSNSLICATLGSFFL 368 + + +SLVL SA S D + NSLIC +LG FFL Sbjct: 524 VLMASSLVLFLSAVSPDFVLGNSLICMSLGVFFL 557 >11_06_0289 - 21969248-21973516 Length = 1422 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 9/75 (12%) Frame = +1 Query: 13 KKNKEIDTNSERTKEQDSGSEK-----DSDFDSDGNYVGEKELQADFEGRNPEDSDFH-- 171 ++ E+ +E KEQ +G E+ D+D D D N + E + + + + E+ H Sbjct: 488 EEQNEVRKETEGRKEQVAGEEEEKEDHDADNDEDSNDDDDDEEEEEEDDDDDEEEPIHLH 547 Query: 172 --GIKQLLRQLFLKS 210 +Q+LR++F K+ Sbjct: 548 EDQYEQILREVFTKN 562 >02_01_0625 + 4690607-4690696,4692673-4692734,4692867-4693230 Length = 171 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 31 DTNSERTKEQDSGSEKDSDFDSDG-NYVGEKELQADFEGRNPEDSD 165 + N E + D G E D D D DG + GE E + D E E+ + Sbjct: 111 EANGEGGSDDDDGGEDDDDEDEDGDDDEGEGEGEDDDEDEEEEEEE 156 >11_06_0284 + 21909758-21913645 Length = 1295 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 6/72 (8%) Frame = +1 Query: 13 KKNKEIDTNSERTKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD----FHGIK 180 +K + E ++ D + D D+D D E+E + D + + +D D H + Sbjct: 498 EKEGRKEVGEEEKEDDDDDYDDDDDYDDDDYDDNEEEKKYDDDDDDDDDDDDPIHLHTAQ 557 Query: 181 --QLLRQLFLKS 210 Q+L+++FLK+ Sbjct: 558 YMQILQEVFLKT 569 >03_04_0130 + 17543991-17545758,17545889-17545971,17546396-17546467 Length = 640 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +1 Query: 1 KMPNKKNKEIDTNSERTKEQDSGSEKDSDFDSDGNYVGEKELQADFEG 144 K NKK K TN ++ K + +D+D D D + +L+A G Sbjct: 120 KKKNKKKKSKKTNLKQKKAAEPKPPRDTDDDEDDEEEADDDLEALLAG 167 >01_01_0231 + 1951047-1951499 Length = 150 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 367 KEKMNPVWHRSENCLQNYLRRMQIPE 444 KE N WHR E ++RR ++PE Sbjct: 88 KEDKNDKWHRVERSSGQFMRRFRLPE 113 >01_01_0230 - 1946079-1946786,1946981-1947141,1948010-1948457 Length = 438 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 367 KEKMNPVWHRSENCLQNYLRRMQIPE 444 KE N WHR E ++RR ++PE Sbjct: 88 KEDKNDKWHRVERSSGQFMRRFRLPE 113 >01_01_0229 - 1943473-1943922 Length = 149 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 367 KEKMNPVWHRSENCLQNYLRRMQIPE 444 KE N WHR E ++RR ++PE Sbjct: 87 KEDKNDKWHRVERSSGQFMRRFRLPE 112 >04_04_1098 + 30876785-30876835,30876846-30877171,30877396-30877418, 30877687-30879392 Length = 701 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +1 Query: 1 KMPNKKNKEIDTNSE-RTKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPED 159 K ++ + E D+ S+ + ++ S DS+ DSDG+Y G+K + G+N D Sbjct: 306 KKSSRHDSESDSESDHKNARREKSSRHDSESDSDGDY-GKKTTK---HGKNDRD 355 >03_02_0619 + 9904405-9904586,9905315-9906764,9907320-9907509, 9909578-9910164 Length = 802 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -3 Query: 245 IIIWASPPRST-FDFRNSCLSSCLIPWKS 162 I W P R FD N+ LS L PWKS Sbjct: 695 ISAWPRPERRLLFDLANTVLSEILAPWKS 723 >03_01_0617 + 4532651-4532893,4534713-4534939,4535077-4535150, 4535753-4535809,4535940-4536280,4536979-4537047, 4537152-4537219,4537404-4539569,4540101-4540178, 4540326-4540437,4540722-4540772,4540886-4540936 Length = 1178 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +1 Query: 13 KKNKEIDTNSERTKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 165 K N + D + + E SGS+ DS+ G+ G + A + DSD Sbjct: 398 KVNNDSDGKAGSSSESGSGSDSDSESSDSGSDSGSQSRSAASGSGSSSDSD 448 >11_01_0678 - 5534879-5534883,5535430-5535529,5535638-5535799, 5536000-5536966,5537444-5537561,5538682-5538871, 5538952-5539107,5539296-5540315 Length = 905 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +1 Query: 13 KKNKEIDTNSERTKEQDSGSEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 165 ++ E +S+ + D E +SD DSDG+ E + +D +G + +DSD Sbjct: 92 REKDEKGEDSDEDESDDDRGEDESDEDSDGD---ESDEHSD-DGESDDDSD 138 >10_01_0209 + 2236530-2237301,2239196-2239297,2239535-2239716, 2240210-2240420,2240526-2240766,2240861-2241011, 2241116-2241424 Length = 655 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 Query: 103 NYVGEKELQADFEGRNPEDSDF 168 N GE+EL D EG+NPE S F Sbjct: 303 NLQGEEELVWDLEGKNPEFSVF 324 >08_01_0618 - 5394841-5395036,5395179-5395244,5395727-5395769, 5396119-5396238,5396653-5396731,5396910-5397177, 5397262-5397305,5397431-5397502,5397756-5397825, 5397929-5397999 Length = 342 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +1 Query: 16 KNKEIDTNSERTKEQDSGSEKDSDFDSD 99 K E D N E +EQD+G E DSDF D Sbjct: 46 KEDEEDDNYE--EEQDAGDEFDSDFGED 71 >04_04_0877 + 29018168-29018279,29019013-29019230,29019333-29019713 Length = 236 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 7 PNKKNKEIDTNSERTKEQDSGSEKDSDFDSDGN 105 PN ++ + KE+D G D D+DS+GN Sbjct: 80 PNTNETKVLRLLKSLKERDGGVYLDEDYDSEGN 112 >01_01_0420 + 3175544-3176696,3177035-3178581,3179623-3179688, 3179892-3179999 Length = 957 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +3 Query: 558 YRLNLRKLIGKICYTTLNTLFGSVKLTLLESHQKCFLQIK 677 + +NLR+ +G + T F + +++ E CF +IK Sbjct: 901 FDINLRRQLGALSSKTFEVFFKLINISISEDETVCFNRIK 940 >11_06_0185 + 21018045-21022307 Length = 1420 Score = 27.9 bits (59), Expect = 8.2 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 9/75 (12%) Frame = +1 Query: 13 KKNKEIDTNSERTKEQDSGSEK-----DSDFDSDGNYVGEKELQADFEGRNPEDSDFH-- 171 ++ E+ +E KEQ +G E+ D+D D D N + E + + E + E+ H Sbjct: 487 EEQNEVRKETEGRKEQVAGEEEEKEDHDADNDEDSNDDDDDE-EEEEEDDDDEEEPIHLH 545 Query: 172 --GIKQLLRQLFLKS 210 +Q+LR++F K+ Sbjct: 546 EDQYEQILREVFTKN 560 >08_01_0626 - 5445676-5446687,5447099-5447430 Length = 447 Score = 27.9 bits (59), Expect = 8.2 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Frame = +1 Query: 13 KKNKEIDTNSERTKEQDSGSEK---DSDFDSDGNYVGEKELQADF-EGRNPED 159 ++++EI+ + + + D E+ D D D D N V E+E D EG + E+ Sbjct: 229 EEDEEIEEDEDENNDDDDEEEEMEEDEDLDEDKNDVVEEEEDEDMDEGEDDEN 281 >07_03_1762 - 29299328-29299437,29299782-29299871,29300487-29301291, 29301956-29303278 Length = 775 Score = 27.9 bits (59), Expect = 8.2 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 4/59 (6%) Frame = +1 Query: 1 KMPNKKNKEIDTNSERTKEQDSG----SEKDSDFDSDGNYVGEKELQADFEGRNPEDSD 165 K P K + R K+ D E+D+DFD D + E+E+ D E +D D Sbjct: 99 KRPPKGKPPPRSRRRRQKDDDDDYEEEEEEDADFDPDVDEDDEEEVDEDEEEFEQDDDD 157 >07_01_0566 + 4207894-4207974,4208090-4208144,4208671-4208759, 4209742-4209794,4209966-4210120,4210201-4210528, 4210618-4210730,4211394-4211538,4211951-4212259, 4212340-4212420,4212989-4213349 Length = 589 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +1 Query: 16 KNKEIDTNSERTKEQDSGSEKDSDFDSDGNYVGEKELQADFEGR 147 K+K+ S TK + S + S DSD + G ++ EGR Sbjct: 237 KHKKTKRKSRGTKRKSKRSYRSSSDDSDSSKTGGSSSDSESEGR 280 >03_05_0483 - 24806984-24808324 Length = 446 Score = 27.9 bits (59), Expect = 8.2 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = +1 Query: 10 NKKNKEIDTNSERTKEQDSGS-EKDSDFDSDGNYVGEKE-LQADFEGRNPEDSD 165 +++++E D + E E S ++DSD D D + GEKE ++A R+ EDSD Sbjct: 382 DEEDEEYDDDEEEDMEAGVASGDEDSD-DDDDDEEGEKEDMEAGVASRD-EDSD 433 >02_05_0958 + 33073302-33073442,33073839-33073913,33074382-33074497, 33076863-33076977,33077100-33077228,33078907-33078954, 33079343-33079469,33079634-33079789,33080031-33080287, 33080431-33080580,33080660-33080714,33080793-33081088, 33081252-33081335,33081869-33081941,33082164-33082291, 33082905-33083090,33083179-33083316,33083394-33083519, 33083705-33083965 Length = 886 Score = 27.9 bits (59), Expect = 8.2 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +3 Query: 354 VNITKRKNEPSVAQIRELLTKLSQENADPRTKELIKYILADDSQHTGLVINE 509 +NI + + SV+ I + L LS+ K+L++ ADD+ G NE Sbjct: 689 ININDQSKQASVSLILDSLKDLSEAELSTIRKQLLEEFSADDACPLGSHSNE 740 >01_01_0272 - 2249662-2249721,2250110-2250335,2250419-2250615, 2250707-2250955,2251047-2251176,2251473-2251564, 2251735-2251855,2251940-2252028,2252149-2252271, 2252379-2252506,2253039-2253147,2253701-2254000 Length = 607 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 13 KKNKEIDTNSERTKEQDSGSEKDSDFDSDGNYVGEKELQA 132 +K KE S K+ + E SD DSDG+ G+K+ +A Sbjct: 533 EKAKEFVYGSGSRKKSNGKHENSSDDDSDGSCDGKKKKKA 572 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,029,599 Number of Sequences: 37544 Number of extensions: 269968 Number of successful extensions: 1100 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1070 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -