BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00134 (723 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 23 3.3 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 23 3.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.8 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 7.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 7.6 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.6 bits (46), Expect = 3.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 281 LDKLKAERERGITIDIALWKFETSKYYVTII 373 L KLK + G + +A KF K+YV I+ Sbjct: 78 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 108 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 22.6 bits (46), Expect = 3.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 281 LDKLKAERERGITIDIALWKFETSKYYVTII 373 L KLK + G + +A KF K+YV I+ Sbjct: 4 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 34 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.8 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 672 ESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 544 +S ++ + N L V FLL K L + W G+ +YDE Sbjct: 1267 QSVFAFFMMNALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.8 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 672 ESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 544 +S ++ + N L V FLL K L + W G+ +YDE Sbjct: 1267 QSVFAFFMMNALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -3 Query: 703 CCLRAIQKWARKRQQLGCSQSS*CMRIL 620 CC A+ RQ + S+ C+R + Sbjct: 615 CCYHAVAPGTDIRQSIALSRKKKCIRYM 642 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -3 Query: 703 CCLRAIQKWARKRQQLGCSQSS*CMRIL 620 CC A+ RQ + S+ C+R + Sbjct: 507 CCYHAVAPGTDIRQSIALSRKKKCIRYM 534 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,755 Number of Sequences: 336 Number of extensions: 3930 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -