BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00133 (753 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schiz... 31 0.13 SPAC17A2.14 ||SPAC17G6.01|CorA family magnesium ion transporter|... 28 1.6 SPBC1539.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 27 2.9 SPCC830.03 |||AAA family ATPase Grc3 |Schizosaccharomyces pombe|... 27 3.8 SPAC1486.09 |||ribosome biogenesis protein Nob1 |Schizosaccharom... 26 6.6 SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pomb... 25 8.8 >SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1273 Score = 31.5 bits (68), Expect = 0.13 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 2/74 (2%) Frame = +1 Query: 298 LGSTIKTEKDKFQINLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKY- 474 +G T + E D+F N V +F P+ + + K +E+ DEH Q V + Sbjct: 1048 IGETSRKELDQFLRNSKVNNFDPNAEAQRHLSYQARYRLKKQERLDEHKEEQEQLVTELL 1107 Query: 475 -SLPEGAETANVAP 513 LPE N P Sbjct: 1108 GYLPEPPSKPNANP 1121 >SPAC17A2.14 ||SPAC17G6.01|CorA family magnesium ion transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 617 Score = 27.9 bits (59), Expect = 1.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 595 VIGTTLSPLSSITFLGAVTVKIPSAD 518 ++GT L PL+ +T L + VK+P D Sbjct: 561 ILGTILIPLNLVTGLWGMNVKVPGQD 586 >SPBC1539.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 386 Score = 27.1 bits (57), Expect = 2.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 140 EECPCKKQRDNKLVDQDFGMPLTPDD 217 EE KK +D ++VD FG+ L+ DD Sbjct: 338 EEEERKKGKDGQIVDAGFGLVLSKDD 363 >SPCC830.03 |||AAA family ATPase Grc3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 736 Score = 26.6 bits (56), Expect = 3.8 Identities = 12/46 (26%), Positives = 27/46 (58%) Frame = +1 Query: 142 RMSL*KAARQQTCGSGLRDAANSGRLLNKHDDAVDSSRYFRPWRHT 279 +++L KAAR++ SG + + + +K++D + + F ++HT Sbjct: 21 QLTLSKAARKKDNSSGKKRSVSEEESQDKYEDEMKTEGEFPSYKHT 66 >SPAC1486.09 |||ribosome biogenesis protein Nob1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 388 Score = 25.8 bits (54), Expect = 6.6 Identities = 19/81 (23%), Positives = 35/81 (43%) Frame = +1 Query: 277 TASLARDLGSTIKTEKDKFQINLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISR 456 TAS+ S K+ +++ QH + E T E + +EE ++ G+I+ Sbjct: 137 TASVKETENSDPKSAENEVLEGETTQHSNNKEAHPNTEENKE--QEDNEEDDEDDGWITP 194 Query: 457 QFVRKYSLPEGAETANVAPSY 519 +RK +G + V P + Sbjct: 195 SNIRKKKAEDGVGESLVQPKH 215 >SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1428 Score = 25.4 bits (53), Expect = 8.8 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +1 Query: 298 LGSTIKTEKDKFQINLDVQHFSPDEISVKTAEGYVVVEA 414 L S+I+ EK + LD++ +SP+E+ + Y + EA Sbjct: 475 LKSSIEKEKVEIVPFLDIRKYSPNEVLCMSPFWYPIPEA 513 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,938,227 Number of Sequences: 5004 Number of extensions: 58909 Number of successful extensions: 185 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 185 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 359287726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -