BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00130 (658 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|... 26 4.2 SPBC646.05c |erg9||squalene synthase Erg9|Schizosaccharomyces po... 25 7.3 SPBC685.03 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 25 9.6 SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 9.6 >SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1184 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +1 Query: 289 LINCVLLKFTNIYSRRFSQDISHRTLRSSSKI*HGL 396 L+ + L+ N Y+ +SQD+ T R++S++ HG+ Sbjct: 229 LVGHIPLRAAN-YANEYSQDVPASTHRAASELVHGV 263 >SPBC646.05c |erg9||squalene synthase Erg9|Schizosaccharomyces pombe|chr 2|||Manual Length = 460 Score = 25.4 bits (53), Expect = 7.3 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -1 Query: 157 LPLTYRGRDVFIQLLYTI*FRSLYAMLL*SINLKRVCDVLL 35 L +R DVF Q I ++L S+NLK VCD+ L Sbjct: 304 LAAVFRNPDVF-QTNVKIRKGQAVQIILHSVNLKNVCDLFL 343 >SPBC685.03 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 452 Score = 25.0 bits (52), Expect = 9.6 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -1 Query: 550 YIK*NGSGHFISRNKRIRRTLDNYVFAVRTISFDD*TVPY 431 Y+ NG GHF+ + D YV TI+ + VP+ Sbjct: 411 YLSDNGDGHFVLAGDGNQTIGDFYVMNWTTIASGEYLVPF 450 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 25.0 bits (52), Expect = 9.6 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +2 Query: 179 FFRFLFTMMTNRKFSIALFLWYWDVNDVSSSDLRFIY*SIAFY 307 FF F F R+F IA+F+ +D N V F + +F+ Sbjct: 78 FFFFFFFFSHCRRFHIAIFIHPYDSNVVPFFCFFFYFSLFSFF 120 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,607,966 Number of Sequences: 5004 Number of extensions: 52417 Number of successful extensions: 91 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -