BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00128 (795 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family prot... 29 3.6 At5g05360.2 68418.m00577 expressed protein similar to unknown pr... 29 3.6 At5g05360.1 68418.m00578 expressed protein similar to unknown pr... 29 3.6 At1g77240.1 68414.m08996 AMP-binding protein, putative strong si... 29 4.7 At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi... 28 8.2 At3g62370.1 68416.m07006 expressed protein 28 8.2 At2g44220.1 68415.m05503 expressed protein and genefinder conta... 28 8.2 >At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family protein similar to SP|P22418 Fructose-1,6-bisphosphatase, chloroplast precursor (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase) (FBPase) {Spinacia oleracea}; contains Pfam profile PF00316: fructose-1,6-bisphosphatase Length = 404 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -3 Query: 154 ATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 44 A+ + SP+N+ L S SS +D P PL +VS D Sbjct: 105 ASLVASPFNSSLGKLSVNSSSGSDRDAPKPLDIVSND 141 >At5g05360.2 68418.m00577 expressed protein similar to unknown protein (pir||T02500) Length = 153 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -2 Query: 263 ARRIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 129 A R+ P P+R S V ++ +R+T SHL Y++ V L+ Sbjct: 12 AIRLSSENPTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56 >At5g05360.1 68418.m00578 expressed protein similar to unknown protein (pir||T02500) Length = 163 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -2 Query: 263 ARRIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 129 A R+ P P+R S V ++ +R+T SHL Y++ V L+ Sbjct: 12 AIRLSSENPTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56 >At1g77240.1 68414.m08996 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 545 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -2 Query: 386 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNET 270 +P SNS P +VL + A + GD H TT+H W+ET Sbjct: 5 LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45 >At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin like protein A, Arabidopsis thaliana, gb:Q07970 Length = 790 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 248 DRAPLPPNRVSNETMKVVVFQRRSRET 168 +RAPLP V E + + F +R +ET Sbjct: 7 NRAPLPSPNVKKEALSSIPFDKRRKET 33 >At3g62370.1 68416.m07006 expressed protein Length = 361 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -2 Query: 371 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 276 N+ PG + P G NG +RF H+ ++AWN Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193 >At2g44220.1 68415.m05503 expressed protein and genefinder contains Pfam profile PF03080: Arabidopsis proteins of unknown function Length = 393 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 675 NPTLGEFFAMIGRADIEGSKSNVAMNAWLPQASYP 571 +PTLG +A++G + + + VA+N W P P Sbjct: 140 DPTLGHQYALMGVRNGKFYGTEVAINLWKPYVQIP 174 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,769,657 Number of Sequences: 28952 Number of extensions: 387611 Number of successful extensions: 1081 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1040 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1081 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1794809600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -