BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00123 (596 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 2.0 AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 22 4.5 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 6.0 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 21 6.0 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 21 6.0 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 57 CPHGGTPFIKEETHNLEYFCR 119 CP PFI E H+LEY R Sbjct: 233 CPK--CPFITEYKHHLEYHLR 251 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 592 FHSLFIPNKIQLNLNWFY 539 FH L + NK ++ N++Y Sbjct: 49 FHPLALSNKNAIDFNYYY 66 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 6.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 388 KSINEEEEHAKSLDESKKNFRKYIDHNKS 474 +++NE EH + + E K R I+ KS Sbjct: 466 ETLNEHLEHLRQVFEKLKQARMTINLEKS 494 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 21.4 bits (43), Expect = 6.0 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = +2 Query: 83 QRGNPQLRVFLPNFWMKLVRPHPKQLPNIVHFHCSMEMTKYDIKNYLEKIYE 238 Q G R+ NF L + + P +HFH S +K + K L K E Sbjct: 388 QTGEQFARLLRHNFNRHL---NSNRAPLGLHFHASWLKSKKEFKEELIKFIE 436 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 21.4 bits (43), Expect = 6.0 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = +2 Query: 83 QRGNPQLRVFLPNFWMKLVRPHPKQLPNIVHFHCSMEMTKYDIKNYLEKIYE 238 Q G R+ NF L + + P +HFH S +K + K L K E Sbjct: 395 QTGEQFARLLRHNFNRHL---NSNRAPLGLHFHASWLKSKKEFKEELIKFIE 443 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,848 Number of Sequences: 336 Number of extensions: 2531 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -