BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00123 (596 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0701 - 5774234-5774404,5774456-5774456,5774558-5774763,577... 29 3.7 09_06_0371 + 22615809-22617431,22618312-22618422,22619361-226194... 28 6.5 >11_01_0701 - 5774234-5774404,5774456-5774456,5774558-5774763, 5775157-5775303,5775423-5775628,5776391-5776580 Length = 306 Score = 28.7 bits (61), Expect = 3.7 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 6/58 (10%) Frame = +1 Query: 313 KEDDVKVA-FVTLPKTMTFKYPDLFEKSINEEE---EHAKSLD--ESKKNFRKYIDHN 468 KED+ A + P YPDLFE+ E H+ S++ + KK +Y HN Sbjct: 42 KEDEETTADLLDAPPVFLIDYPDLFERGWGWERLFPYHSSSVEWPQFKKYLEEYSSHN 99 >09_06_0371 + 22615809-22617431,22618312-22618422,22619361-22619453, 22619562-22619661,22619754-22619834,22620774-22621047, 22621254-22622069,22622921-22623029,22623509-22623602, 22623881-22623939,22624150-22624197 Length = 1135 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +2 Query: 98 QLRVFLPNFWMKLVRPHPKQLPNIVHFHCSMEMTKYDI 211 +L VF P W ++ H ++ NI+ +E+ DI Sbjct: 547 RLTVFYPTLWKTVIASHSQECENIIVLRKMLELRTGDI 584 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,600,914 Number of Sequences: 37544 Number of extensions: 219431 Number of successful extensions: 480 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -