BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00120 (464 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 26 0.23 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 25 0.53 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 25 0.53 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 22 2.8 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 21 8.6 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 8.6 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 25.8 bits (54), Expect = 0.23 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 113 LPRSIQVQDKEGALHCSRSLYTGQFVYCGK 202 L +S++ DKE L LY +F Y GK Sbjct: 508 LNKSLKYSDKERDLSLRMILYFSEFAYLGK 537 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 24.6 bits (51), Expect = 0.53 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -3 Query: 291 ITHFLFKIAHNGTSGMAPTGITFPTSRVAFF 199 + HF F + HN M + FP R F+ Sbjct: 228 LNHFYFMLNHNYPPFMLSNSLNFPQIRGEFY 258 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 24.6 bits (51), Expect = 0.53 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -3 Query: 291 ITHFLFKIAHNGTSGMAPTGITFPTSRVAFF 199 + HF F + HN M + FP R F+ Sbjct: 228 LNHFYFMLNHNYPPFMLSNSLNFPQIRGEFY 258 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 22.2 bits (45), Expect = 2.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 334 IGHNPDAKRTRVKLPSGAKKVL 399 IG+ + K+TR LP+G +KVL Sbjct: 57 IGYGSN-KKTRHMLPTGFRKVL 77 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 20.6 bits (41), Expect = 8.6 Identities = 6/21 (28%), Positives = 13/21 (61%) Frame = -1 Query: 446 RPPPATIPTMPLLLDGRTFLA 384 +P P +P++++GR +A Sbjct: 218 KPTPVQKHALPIIMNGRDLMA 238 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 20.6 bits (41), Expect = 8.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 353 ASGLCPITVAKFPEARA 303 AS C + K+P+ARA Sbjct: 624 ASSYCGLRDRKYPDARA 640 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,343 Number of Sequences: 438 Number of extensions: 3287 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12436029 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -