BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00118 (391 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC070378-1|AAH70378.1| 158|Homo sapiens basic transcription fac... 84 1e-16 BC022371-1|AAH22371.1| 158|Homo sapiens BTF3L4 protein protein. 84 1e-16 BC021004-1|AAH21004.1| 153|Homo sapiens BTF3L4 protein protein. 84 1e-16 AL445685-6|CAI17032.1| 158|Homo sapiens basic transcription fac... 84 1e-16 AL139156-5|CAI22856.1| 158|Homo sapiens basic transcription fac... 84 1e-16 AK027750-1|BAB55342.1| 158|Homo sapiens protein ( Homo sapiens ... 84 1e-16 M90354-1|AAA58400.1| 111|Homo sapiens BTF3 homologue protein. 77 3e-14 X74070-1|CAA52200.1| 162|Homo sapiens transcription factor BTF3... 76 4e-14 X53281-1|CAA37376.1| 162|Homo sapiens general transcription fac... 76 4e-14 X53280-1|CAA37375.1| 206|Homo sapiens general transcription fac... 76 4e-14 BT007120-1|AAP35784.1| 162|Homo sapiens basic transcription fac... 76 4e-14 BC008062-1|AAH08062.1| 162|Homo sapiens basic transcription fac... 76 4e-14 AB062126-1|BAB93458.1| 162|Homo sapiens transcription factor BT... 76 4e-14 M90356-1|AAA58401.1| 214|Homo sapiens BTF3 homologue protein. 72 6e-13 M90357-1|AAA58398.1| 158|Homo sapiens basic transcription facto... 59 4e-09 M90355-1|AAB04035.1| 67|Homo sapiens BTF3 homologue protein. 50 4e-06 BC062736-1|AAH62736.1| 102|Homo sapiens LOC503543 protein protein. 48 1e-05 >BC070378-1|AAH70378.1| 158|Homo sapiens basic transcription factor 3-like 4 protein. Length = 158 Score = 84.2 bits (199), Expect = 1e-16 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL+VN I GIEEVNMIK+DGTVIHFNNPK QASL+ANTFAITGH Sbjct: 44 KKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGH 88 Score = 76.2 bits (179), Expect = 4e-14 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = +1 Query: 124 MNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLK 255 MN EKL KLQ+QVRIGGKGT RRKKKVVH TA DDKKLQSSLK Sbjct: 1 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLK 44 >BC022371-1|AAH22371.1| 158|Homo sapiens BTF3L4 protein protein. Length = 158 Score = 84.2 bits (199), Expect = 1e-16 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL+VN I GIEEVNMIK+DGTVIHFNNPK QASL+ANTFAITGH Sbjct: 44 KKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGH 88 Score = 76.2 bits (179), Expect = 4e-14 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = +1 Query: 124 MNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLK 255 MN EKL KLQ+QVRIGGKGT RRKKKVVH TA DDKKLQSSLK Sbjct: 1 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLK 44 >BC021004-1|AAH21004.1| 153|Homo sapiens BTF3L4 protein protein. Length = 153 Score = 84.2 bits (199), Expect = 1e-16 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL+VN I GIEEVNMIK+DGTVIHFNNPK QASL+ANTFAITGH Sbjct: 39 KKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGH 83 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +1 Query: 175 KGTPRRKKKVVHVTAATDDKKLQSSLK 255 +GT RRKKKVVH TA DDKKLQSSLK Sbjct: 13 QGTARRKKKVVHRTATADDKKLQSSLK 39 >AL445685-6|CAI17032.1| 158|Homo sapiens basic transcription factor 3-like 4 protein. Length = 158 Score = 84.2 bits (199), Expect = 1e-16 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL+VN I GIEEVNMIK+DGTVIHFNNPK QASL+ANTFAITGH Sbjct: 44 KKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGH 88 Score = 76.2 bits (179), Expect = 4e-14 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = +1 Query: 124 MNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLK 255 MN EKL KLQ+QVRIGGKGT RRKKKVVH TA DDKKLQSSLK Sbjct: 1 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLK 44 >AL139156-5|CAI22856.1| 158|Homo sapiens basic transcription factor 3-like 4 protein. Length = 158 Score = 84.2 bits (199), Expect = 1e-16 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL+VN I GIEEVNMIK+DGTVIHFNNPK QASL+ANTFAITGH Sbjct: 44 KKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGH 88 Score = 76.2 bits (179), Expect = 4e-14 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = +1 Query: 124 MNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLK 255 MN EKL KLQ+QVRIGGKGT RRKKKVVH TA DDKKLQSSLK Sbjct: 1 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLK 44 >AK027750-1|BAB55342.1| 158|Homo sapiens protein ( Homo sapiens cDNA FLJ14844 fis, clone PLACE1000133, highly similar to TRANSCRIPTION FACTOR BTF3. ). Length = 158 Score = 84.2 bits (199), Expect = 1e-16 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL+VN I GIEEVNMIK+DGTVIHFNNPK QASL+ANTFAITGH Sbjct: 44 KKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGH 88 Score = 76.2 bits (179), Expect = 4e-14 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = +1 Query: 124 MNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLK 255 MN EKL KLQ+QVRIGGKGT RRKKKVVH TA DDKKLQSSLK Sbjct: 1 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLK 44 >M90354-1|AAA58400.1| 111|Homo sapiens BTF3 homologue protein. Length = 111 Score = 76.6 bits (180), Expect = 3e-14 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL VN IPGIEEVNM GTVIHFNNP+ QASLAANTF +TGH Sbjct: 45 KKLGVNNIPGIEEVNMFTHQGTVIHFNNPEVQASLAANTFTMTGH 89 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/49 (55%), Positives = 33/49 (67%) Frame = +1 Query: 109 LKNSRMNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLK 255 +K + MN +KL K Q++V G KGT R KKVVH TA +DKK Q SLK Sbjct: 1 MKETIMN-QKLTKRQAEVHTGRKGTAHR-KKVVHTTA--EDKKFQFSLK 45 >X74070-1|CAA52200.1| 162|Homo sapiens transcription factor BTF3 protein. Length = 162 Score = 76.2 bits (179), Expect = 4e-14 Identities = 35/45 (77%), Positives = 36/45 (80%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL VN I GIEEVNM GTVIHFNNPK QASLAANTF ITGH Sbjct: 49 KKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGH 93 Score = 75.8 bits (178), Expect = 5e-14 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = +1 Query: 109 LKNSRMNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLK 255 +K + MN EKL KLQ+QVRIGGKGT RRKKKVVH TA DDKKLQ SLK Sbjct: 1 MKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLK 49 >X53281-1|CAA37376.1| 162|Homo sapiens general transcription factor protein. Length = 162 Score = 76.2 bits (179), Expect = 4e-14 Identities = 35/45 (77%), Positives = 36/45 (80%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL VN I GIEEVNM GTVIHFNNPK QASLAANTF ITGH Sbjct: 49 KKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGH 93 Score = 75.8 bits (178), Expect = 5e-14 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = +1 Query: 109 LKNSRMNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLK 255 +K + MN EKL KLQ+QVRIGGKGT RRKKKVVH TA DDKKLQ SLK Sbjct: 1 MKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLK 49 >X53280-1|CAA37375.1| 206|Homo sapiens general transcription factor protein. Length = 206 Score = 76.2 bits (179), Expect = 4e-14 Identities = 35/45 (77%), Positives = 36/45 (80%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL VN I GIEEVNM GTVIHFNNPK QASLAANTF ITGH Sbjct: 93 KKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGH 137 Score = 75.8 bits (178), Expect = 5e-14 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = +1 Query: 109 LKNSRMNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLK 255 +K + MN EKL KLQ+QVRIGGKGT RRKKKVVH TA DDKKLQ SLK Sbjct: 45 MKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLK 93 >BT007120-1|AAP35784.1| 162|Homo sapiens basic transcription factor 3 protein. Length = 162 Score = 76.2 bits (179), Expect = 4e-14 Identities = 35/45 (77%), Positives = 36/45 (80%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL VN I GIEEVNM GTVIHFNNPK QASLAANTF ITGH Sbjct: 49 KKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGH 93 Score = 75.8 bits (178), Expect = 5e-14 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = +1 Query: 109 LKNSRMNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLK 255 +K + MN EKL KLQ+QVRIGGKGT RRKKKVVH TA DDKKLQ SLK Sbjct: 1 MKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLK 49 >BC008062-1|AAH08062.1| 162|Homo sapiens basic transcription factor 3 protein. Length = 162 Score = 76.2 bits (179), Expect = 4e-14 Identities = 35/45 (77%), Positives = 36/45 (80%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL VN I GIEEVNM GTVIHFNNPK QASLAANTF ITGH Sbjct: 49 KKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGH 93 Score = 75.8 bits (178), Expect = 5e-14 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = +1 Query: 109 LKNSRMNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLK 255 +K + MN EKL KLQ+QVRIGGKGT RRKKKVVH TA DDKKLQ SLK Sbjct: 1 MKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLK 49 >AB062126-1|BAB93458.1| 162|Homo sapiens transcription factor BTF 3 protein. Length = 162 Score = 76.2 bits (179), Expect = 4e-14 Identities = 35/45 (77%), Positives = 36/45 (80%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL VN I GIEEVNM GTVIHFNNPK QASLAANTF ITGH Sbjct: 49 KKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGH 93 Score = 75.8 bits (178), Expect = 5e-14 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = +1 Query: 109 LKNSRMNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLK 255 +K + MN EKL KLQ+QVRIGGKGT RRKKKVVH TA DDKKLQ SLK Sbjct: 1 MKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLK 49 >M90356-1|AAA58401.1| 214|Homo sapiens BTF3 homologue protein. Length = 214 Score = 72.1 bits (169), Expect = 6e-13 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = +3 Query: 252 QKLSVNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +KL VN I GIE+VNM GTVIHFNNPK QASLA NTF ITGH Sbjct: 79 KKLQVNNISGIEKVNMFTNQGTVIHFNNPKFQASLAVNTFTITGH 123 Score = 65.3 bits (152), Expect = 7e-11 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = +1 Query: 106 TLKNSRMNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLKSCQ 264 T +++ KL KLQ+QVRIGGKGT RKKKV H TA DDKKLQ SLK Q Sbjct: 30 TCRSTDHEPGKLAKLQAQVRIGGKGTAHRKKKVFHRTATADDKKLQFSLKKLQ 82 >M90357-1|AAA58398.1| 158|Homo sapiens basic transcription factor 3a protein. Length = 158 Score = 59.3 bits (137), Expect = 4e-09 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +3 Query: 288 EVNMIKEDGTVIHFNNPKAQASLAANTFAITGH 386 +VNM GTVIHFNNPK QASLAANTF ITGH Sbjct: 67 KVNMFTNQGTVIHFNNPKVQASLAANTFTITGH 99 Score = 35.9 bits (79), Expect = 0.047 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = +1 Query: 109 LKNSRMNSEKLKKLQSQVRIGGK 177 +K + MN EKL KLQ+QVRIGGK Sbjct: 45 MKETIMNQEKLAKLQAQVRIGGK 67 >M90355-1|AAB04035.1| 67|Homo sapiens BTF3 homologue protein. Length = 67 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/52 (51%), Positives = 34/52 (65%) Frame = +1 Query: 109 LKNSRMNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTAATDDKKLQSSLKSCQ 264 +K + MN EKL KLQ++V IGG +KKVVH TA +DKK Q SLK + Sbjct: 1 MKETIMNQEKLAKLQAKVPIGGTA---HRKKVVHRTATANDKKRQFSLKKLE 49 >BC062736-1|AAH62736.1| 102|Homo sapiens LOC503543 protein protein. Length = 102 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/33 (63%), Positives = 24/33 (72%) Frame = +3 Query: 291 VNMIKEDGTVIHFNNPKAQASLAANTFAITGHG 389 +N K T+IHFNNP+ QA LA NTF ITGHG Sbjct: 1 MNQEKLQRTMIHFNNPEVQAFLAVNTFTITGHG 33 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,851,282 Number of Sequences: 237096 Number of extensions: 983925 Number of successful extensions: 5787 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 5738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5786 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2698607930 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -