BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00117 (610 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPYUK71.03c |||C2 domain protein|Schizosaccharomyces pombe|chr... 35 0.008 SPAC11E3.02c |||C2 domain protein|Schizosaccharomyces pombe|chr ... 28 1.2 SPCC1322.11 |rpl2302|rpl23-2|60S ribosomal protein L23|Schizosac... 28 1.2 SPAC3G9.03 |rpl2301|rpl23-1|60S ribosomal protein L23|Schizosacc... 28 1.2 SPAC12G12.10 |||WD repeat protein, human WDR21 family|Schizosacc... 25 8.7 SPAC3C7.07c |||arginine-tRNA protein transferase |Schizosaccharo... 25 8.7 >SPAPYUK71.03c |||C2 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1225 Score = 35.1 bits (77), Expect = 0.008 Identities = 30/115 (26%), Positives = 59/115 (51%), Gaps = 6/115 (5%) Frame = +1 Query: 199 TKVRVEKQKI*RTEEAYEILVNIVLIEAKDLPDDQTTTCNGLYCKFKL-GNESHKSRQVL 375 T V V+ +++ E E+ V++ I+A DLP + + + F+L G E ++++ Sbjct: 1021 TPVPVKLEEVEMYENMGEMTVDV--IKATDLPAADSNGKSDPFVVFELQGEEVYRTKTHK 1078 Query: 376 KT-KPAWCERFNIYL--YEENNLEVSL--WHKGKQKNFMGRCVIDLSRLEKKRLT 525 +T P + E F + L + N ++ W G + + +G CVID L++++ T Sbjct: 1079 RTLNPTFNESFEVELPCKQTCNFVANVFDWDFGNKDDHLGSCVIDCKLLQQQQQT 1133 >SPAC11E3.02c |||C2 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1237 Score = 27.9 bits (59), Expect = 1.2 Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = +1 Query: 343 GNESHKSRQVLKTKPAWCERFNIYLYEENNLEVSLWHKGK--QKNFMGRCVIDLS 501 G K+R + P W + F + + + +LW KGK GR LS Sbjct: 838 GRRIGKTRPIHSMNPRWDDTFEVKTKDALMITANLWSKGKFNDHEIFGRSSFTLS 892 >SPCC1322.11 |rpl2302|rpl23-2|60S ribosomal protein L23|Schizosaccharomyces pombe|chr 3|||Manual Length = 139 Score = 27.9 bits (59), Expect = 1.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 370 VLKTKPAWCERFNIYLYEENNLEVSLWHKGKQK 468 V++ + AW + +YLY E+N V + KG+ K Sbjct: 80 VVRQRKAWRRKDGVYLYFEDNAGVIVNPKGEMK 112 >SPAC3G9.03 |rpl2301|rpl23-1|60S ribosomal protein L23|Schizosaccharomyces pombe|chr 1|||Manual Length = 139 Score = 27.9 bits (59), Expect = 1.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 370 VLKTKPAWCERFNIYLYEENNLEVSLWHKGKQK 468 V++ + AW + +YLY E+N V + KG+ K Sbjct: 80 VVRQRKAWRRKDGVYLYFEDNAGVIVNPKGEMK 112 >SPAC12G12.10 |||WD repeat protein, human WDR21 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 420 Score = 25.0 bits (52), Expect = 8.7 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +2 Query: 476 WE-DASLTFLDSKRKDSRYLAGIGMWIR 556 W+ D SL F + + D +YL G W++ Sbjct: 373 WKTDCSLPFKEMRVDDGKYLCRDGSWVK 400 >SPAC3C7.07c |||arginine-tRNA protein transferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 361 Score = 25.0 bits (52), Expect = 8.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 525 DIWQELECGYGFIHM 569 +IW LECGY + +M Sbjct: 202 EIWLALECGYRYYYM 216 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,525,418 Number of Sequences: 5004 Number of extensions: 51025 Number of successful extensions: 156 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -