BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00116 (707 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g78980.1 68414.m09209 leucine-rich repeat transmembrane prote... 28 7.0 At3g49400.1 68416.m05400 transducin family protein / WD-40 repea... 27 9.2 >At1g78980.1 68414.m09209 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 2 GI:3360291 from [Zea mays] Length = 693 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 353 PSVH*KTLRAATVLTKVNYVCRLVSHCLVKFYLCKVKCS 469 PSV K ++++ +L + RL + L KFYL +K S Sbjct: 517 PSVMHKNIKSSNILLDADLNPRLSDYGLSKFYLVSIKTS 555 >At3g49400.1 68416.m05400 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); low similarity (47%) to Agamous-like MADS box protein AGL5 (SP:P29385) {Arabidopsis thaliana} Length = 892 Score = 27.5 bits (58), Expect = 9.2 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 260 SCNPMLFAFEAKKIPVCSLKKNFLHAKKYICPSVH*K 370 S N A E +K P C+ NF A++ C S H K Sbjct: 759 SSNSTETALEEEKCPYCAAPVNFHSAEEAFCESSHQK 795 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,532,643 Number of Sequences: 28952 Number of extensions: 297122 Number of successful extensions: 569 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -