BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00113 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 79 2e-15 SB_6621| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_50378| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 78 5e-15 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_8314| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 46 2e-05 SB_8138| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 46 2e-05 SB_47199| Best HMM Match : ATP-gua_PtransN (HMM E-Value=9.6e-15) 32 0.35 SB_54283| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.4e-13) 31 0.81 SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) 31 0.81 SB_5784| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_14239| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) 29 4.3 SB_6151| Best HMM Match : Extensin_2 (HMM E-Value=2.6) 28 5.7 SB_2246| Best HMM Match : G-patch (HMM E-Value=5.5e-11) 28 5.7 SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35966| Best HMM Match : CpaB (HMM E-Value=3.6) 28 5.7 SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) 28 5.7 SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_48991| Best HMM Match : Rad52_Rad22 (HMM E-Value=5.2e-12) 28 7.6 SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) 28 7.6 SB_25447| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_3503| Best HMM Match : Rad52_Rad22 (HMM E-Value=1e-24) 28 7.6 SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) 28 7.6 SB_24839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_3| Best HMM Match : Peptidase_C21 (HMM E-Value=5) 28 7.6 >SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 725 Score = 79.4 bits (187), Expect = 2e-15 Identities = 39/84 (46%), Positives = 51/84 (60%) Frame = +1 Query: 256 ESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLE 435 ESYS+F+ LFD I+E YH +K DKH + T NLDP G F+ STR+R R+L+ Sbjct: 440 ESYSLFSPLFDKIVEHYHAPYKLADKHTSDMNPEKVTAPNLDPDGVFIRSTRIRVARNLK 499 Query: 436 GYPFNPCLTESQYKEMEDKVSGTL 507 GY P LT + E+E KV+ L Sbjct: 500 GYALTPGLTRKERNEIEKKVTEVL 523 Score = 74.9 bits (176), Expect = 5e-14 Identities = 38/73 (52%), Positives = 51/73 (69%), Gaps = 1/73 (1%) Frame = +2 Query: 32 KAATMVDAATLEKLEAGFSK-LQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQS 208 K+ ++ A +EK + F + L + KSLLKKYLT E+F+SLK+KKT+ G +L DCI S Sbjct: 337 KSLLEIERAAIEKQRSVFPEALNKEECKSLLKKYLTAEMFNSLKDKKTAKGISLYDCINS 396 Query: 209 GVENLDSGVGIYA 247 GV NLDS G+YA Sbjct: 397 GVVNLDSSCGVYA 409 Score = 71.7 bits (168), Expect = 5e-13 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = +3 Query: 510 SLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFW 650 SL G+L G +YPLTGM + T+Q+L+DDHFLFK+GDRFL+AA + W Sbjct: 525 SLTGDLAGKYYPLTGMDEATRQKLVDDHFLFKKGDRFLEAAGVNKLW 571 Score = 62.5 bits (145), Expect = 3e-10 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = +3 Query: 522 ELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFW 650 +L G +YPLTGM + T++QL++DHFLFK+GDRFL AA + W Sbjct: 150 DLAGKYYPLTGMDEVTREQLVNDHFLFKKGDRFLDAAGCNKEW 192 Score = 62.1 bits (144), Expect = 4e-10 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 2/65 (3%) Frame = +1 Query: 256 ESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLE 435 ESY+VFA LFD +IEDYH+ +K D H D +LDP F+ STR+R GR L Sbjct: 93 ESYTVFAPLFDKVIEDYHSPYKLKDGHTSDMNPDRVNAPDLDPDNRFIRSTRIRVGRDLA 152 Query: 436 G--YP 444 G YP Sbjct: 153 GKYYP 157 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/51 (47%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = +2 Query: 44 MVDAATLEKLEAGFS-----KLQGSDSKSLLKKYLTREVFDSLKNKKTSFG 181 M DAA EK + + K + K LLKKYLT +VFD LK KKT G Sbjct: 8 MADAAEAEKYRSKNAYPVPLKSAKCNPKCLLKKYLTNQVFDQLKTKKTKRG 58 >SB_6621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 78.6 bits (185), Expect = 4e-15 Identities = 39/83 (46%), Positives = 51/83 (61%) Frame = +1 Query: 256 ESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLE 435 ESY+VFA LFD +IEDYH+ +K D H D +LDP F+ STR+R GR+L+ Sbjct: 232 ESYTVFAPLFDKVIEDYHSPYKLKDGHTSDMNPDRVNAPDLDPDNRFIRSTRIRVGRNLK 291 Query: 436 GYPFNPCLTESQYKEMEDKVSGT 504 GY P LT+ + E+E K S T Sbjct: 292 GYGLAPSLTKKERVELEKKASFT 314 Score = 37.5 bits (83), Expect = 0.009 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +2 Query: 110 KSLLKKYLTREVFDSLKNKKTSFG 181 K LLKKYLT +VFD LK KKT G Sbjct: 174 KCLLKKYLTNQVFDQLKTKKTKRG 197 >SB_50378| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 969 Score = 78.2 bits (184), Expect = 5e-15 Identities = 39/70 (55%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Frame = +2 Query: 47 VDAATLEKLEAGFSK-LQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL 223 ++ A +E+ F + L+ + KSLLKKYLT +VF+SLK KKTS G+ L DCI SGV NL Sbjct: 614 IERAAIEEAHLKFPEDLKKPEVKSLLKKYLTEDVFNSLKEKKTSRGAGLYDCINSGVVNL 673 Query: 224 DSGVGIYAPD 253 DSG G+YA D Sbjct: 674 DSGTGVYAAD 683 Score = 77.8 bits (183), Expect = 7e-15 Identities = 41/81 (50%), Positives = 50/81 (61%) Frame = +2 Query: 11 DGCSSARKAATMVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTL 190 D + +K + AA K L+ + KSL+KKYLT E+F+ LK+KKT G TL Sbjct: 171 DMYNGVKKLLEIEKAAVEAKRNVFPEVLKKPEVKSLMKKYLTEEMFNELKDKKTELGVTL 230 Query: 191 LDCIQSGVENLDSGVGIYAPD 253 DCI SGVENLDSG GIYA D Sbjct: 231 SDCINSGVENLDSGTGIYAGD 251 Score = 74.1 bits (174), Expect = 9e-14 Identities = 36/80 (45%), Positives = 48/80 (60%) Frame = +1 Query: 256 ESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLE 435 ESY +FA LFD IIEDYH +K KH + +LDP G F+ STR+R R+L+ Sbjct: 253 ESYKLFAPLFDKIIEDYHAPYKLEQKHTSDMNPEKVEAPDLDPEGSFIRSTRIRVARNLK 312 Query: 436 GYPFNPCLTESQYKEMEDKV 495 GY P L++ E+E+KV Sbjct: 313 GYALTPALSKKARLEIEEKV 332 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/84 (44%), Positives = 47/84 (55%) Frame = +1 Query: 256 ESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLE 435 E Y VF ELFD IIEDYH +K + H + NLD G F+ STR+R R+L+ Sbjct: 685 ECYEVFGELFDKIIEDYHAPYKLEENHKSDMDPEKVDAPNLDAEGAFIRSTRIRVARNLK 744 Query: 436 GYPFNPCLTESQYKEMEDKVSGTL 507 GY P LT + ++E KV G L Sbjct: 745 GYALTPGLTRKERVDVESKVVGVL 768 Score = 71.7 bits (168), Expect = 5e-13 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = +3 Query: 510 SLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFW 650 SL G+L G +YPL+GM + T+QQL+DDHFLFK+GDRFL+AA + W Sbjct: 770 SLTGDLAGKYYPLSGMDEATRQQLVDDHFLFKKGDRFLEAAGVNKMW 816 Score = 51.2 bits (117), Expect = 7e-07 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +3 Query: 555 MSKETQQQLIDDHFLFKEGDRFLQAANACRFW 650 M + T+QQL+DDHFLFK+GDRFL+AA R W Sbjct: 1 MDEATRQQLVDDHFLFKKGDRFLEAAGVNREW 32 Score = 50.8 bits (116), Expect = 9e-07 Identities = 20/33 (60%), Positives = 29/33 (87%) Frame = +3 Query: 510 SLEGELKGTFYPLTGMSKETQQQLIDDHFLFKE 608 SL G+L G ++PL GM++ET+QQL++DHFLFK+ Sbjct: 338 SLTGDLAGKYHPLDGMTEETRQQLVNDHFLFKK 370 >SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 775 Score = 72.5 bits (170), Expect = 3e-13 Identities = 37/84 (44%), Positives = 52/84 (61%) Frame = +1 Query: 256 ESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLE 435 ESY FAELFDP+IE+ H+GFKK+DKH G D ++V+S+RVR GRS+ Sbjct: 113 ESYDTFAELFDPVIEERHSGFKKSDKHKTDLDSSKIRGGKFDE--KYVLSSRVRTGRSIR 170 Query: 436 GYPFNPCLTESQYKEMEDKVSGTL 507 G+ P T ++ +E+E V+ L Sbjct: 171 GFSLPPHCTRAERREVERIVNDAL 194 Score = 51.6 bits (118), Expect = 5e-07 Identities = 26/47 (55%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +3 Query: 513 LEGELKGTFYPLTGMSKETQQQLIDDHFLF-KEGDRFLQAANACRFW 650 L G+L G +YPL GMS QQQLIDDHFLF K L A R W Sbjct: 197 LGGDLNGKYYPLNGMSDAQQQQLIDDHFLFDKPVSPLLTCAGMARDW 243 Score = 33.1 bits (72), Expect = 0.20 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 4/51 (7%) Frame = +2 Query: 113 SLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPD 253 +L+ K+LT ++ L++K T G TL IQ+GV+N S VG+ A D Sbjct: 61 NLMAKHLTPRLYVKLRDKSTPNGYTLDQAIQTGVDNPGHPFISTVGLVAGD 111 >SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 70.1 bits (164), Expect = 1e-12 Identities = 37/84 (44%), Positives = 50/84 (59%) Frame = +1 Query: 256 ESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLE 435 ESY VFA+LFDP+IE+ HNG+KKTDKH G+ D +V+STR R GRS+ Sbjct: 454 ESYDVFADLFDPVIEERHNGYKKTDKHVTDLNHRKLKGGSFDE--RYVLSTRCRTGRSIR 511 Query: 436 GYPFNPCLTESQYKEMEDKVSGTL 507 G+ P T ++ + +E V L Sbjct: 512 GFSLPPHCTRAERRSVEKVVVDAL 535 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/47 (51%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +3 Query: 513 LEGELKGTFYPLTGMSKETQQQLIDDHFLF-KEGDRFLQAANACRFW 650 L G+L GT+YPL M+ E Q+QLI+DHFLF K L A R W Sbjct: 538 LGGDLSGTYYPLGKMTNEEQEQLINDHFLFDKPVSPLLTCAGMARDW 584 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = +2 Query: 119 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPD 253 + ++L+ ++ LK+K T G TL IQ+GV+N S VG+ A D Sbjct: 404 MARHLSPRLYTKLKDKVTPNGYTLDMAIQTGVDNPGHPFISTVGLVAGD 452 >SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1115 Score = 69.7 bits (163), Expect = 2e-12 Identities = 35/84 (41%), Positives = 52/84 (61%) Frame = +1 Query: 256 ESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLE 435 ESY VFA++FDP+IE HNG+KKT KH + + +G D ++V+S RVR GRS+ Sbjct: 420 ESYDVFADMFDPVIEKRHNGYKKTAKH-KTDLNPSNLIGGDDLDEKYVLSCRVRTGRSIR 478 Query: 436 GYPFNPCLTESQYKEMEDKVSGTL 507 G P + ++ +E+E V+ L Sbjct: 479 GLCLPPWCSRAERREVEKIVTSAL 502 Score = 66.9 bits (156), Expect = 1e-11 Identities = 36/81 (44%), Positives = 51/81 (62%) Frame = +1 Query: 256 ESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLE 435 ESY VFA++FDP+IE H+G++KTD H D +G D ++V+S RVR GRS+ Sbjct: 51 ESYDVFADMFDPVIEKRHDGYRKTDMHKTDLNPD-HLIGGDDLDEKYVLSCRVRTGRSIR 109 Query: 436 GYPFNPCLTESQYKEMEDKVS 498 G P T ++ +E+E KVS Sbjct: 110 GLGLPPHCTRAERREVE-KVS 129 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/77 (42%), Positives = 44/77 (57%) Frame = +1 Query: 256 ESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLE 435 E+Y VFA L DP+IE HNG+ K KH D + +G D FV+S RVR GRS+ Sbjct: 817 ETYKVFAALLDPVIEARHNGYLKGAKHVTDLNPD-NLVGGDDLDANFVLSCRVRTGRSIR 875 Query: 436 GYPFNPCLTESQYKEME 486 G P T ++ +E+E Sbjct: 876 GLGLPPHCTRAERREVE 892 Score = 51.2 bits (117), Expect = 7e-07 Identities = 25/48 (52%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +3 Query: 510 SLEGELKGTFYPLTGMSKETQQQLIDDHFLF-KEGDRFLQAANACRFW 650 SL+GE KG +YPL+ M+ Q QLIDDHFLF K L A+ R W Sbjct: 135 SLDGEFKGKYYPLSNMTAAEQDQLIDDHFLFDKPVSPLLLASRMARDW 182 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/48 (47%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = +3 Query: 510 SLEGELKGTFYPLTGMSKETQQQLIDDHFLF-KEGDRFLQAANACRFW 650 +L+G LKG +YPL+ M+ Q+QLI+DHFLF K L +A R W Sbjct: 901 TLDGPLKGKYYPLSKMTDAEQEQLINDHFLFDKPVSPLLLSARMARDW 948 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +3 Query: 513 LEGELKGTFYPLTGMSKETQQQLIDDHFLF-KEGDRFLQAANACRFW 650 L+G L G +Y L M++ Q QLIDDHFLF K L A+ R W Sbjct: 505 LDGPLAGKYYSLMTMTEAEQDQLIDDHFLFDKPVSPLLLASRMARDW 551 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +2 Query: 11 DGCSSARKAATMVDAATLEKLEAGFSKLQGSD-SKSLLKKYLTREVFDSLKNKKTSFGST 187 + S AR+ A +A +K + ++ G + ++ + K+LTR+V++ L N KT G T Sbjct: 731 ESVSKAREEAIKKEAER-QKASSTLRRVPGPEQAQHYMAKFLTRDVYNKLCNLKTPSGFT 789 Query: 188 LLDCIQSGVEN 220 L IQ+GV+N Sbjct: 790 LDGVIQTGVDN 800 Score = 31.1 bits (67), Expect = 0.81 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +2 Query: 119 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 220 + K +T++V+ L N +T G TL IQ+GV+N Sbjct: 1 MAKCMTKDVYQRLSNLRTPSGYTLDMAIQTGVDN 34 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 68.9 bits (161), Expect = 3e-12 Identities = 38/81 (46%), Positives = 52/81 (64%) Frame = +1 Query: 256 ESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLE 435 ESY VFAEL DP+IE H G+KKTDKH D G LDP ++V+S+RVR GRS+ Sbjct: 2373 ESYDVFAELLDPVIELRHGGYKKTDKHKTDLNPDNLKGGALDP--KYVLSSRVRTGRSIR 2430 Query: 436 GYPFNPCLTESQYKEMEDKVS 498 G+ P + ++ + +E K+S Sbjct: 2431 GFCLPPHCSRAERRSVE-KIS 2450 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/47 (51%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +3 Query: 513 LEGELKGTFYPLTGMSKETQQQLIDDHFLF-KEGDRFLQAANACRFW 650 L+GE KG +YPL M+ E Q+QLI+DHFLF K L A R W Sbjct: 2457 LDGEFKGKYYPLNKMTDEEQEQLINDHFLFDKPVSPLLTCAGMARDW 2503 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/34 (50%), Positives = 25/34 (73%) Frame = +2 Query: 119 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 220 + K LT+E++ SL++K T G TL D IQ+GV+N Sbjct: 2323 MAKVLTKEIYRSLRDKSTKNGFTLDDIIQTGVDN 2356 >SB_8314| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 309 Score = 46.4 bits (105), Expect = 2e-05 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +1 Query: 256 ESYSVFAELFDPIIEDYHNGFK-KTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSL 432 ESY F + + P+I+ YH GF T KH + + D A ++STR+R R+L Sbjct: 9 ESYDDFKDFYYPVIQAYHKGFDINTSKHVTDMDPEKISTELSDSAKAKIISTRIRVARNL 68 Query: 433 EGYPFNP 453 +P NP Sbjct: 69 SMFPLNP 75 Score = 44.4 bits (100), Expect = 8e-05 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +3 Query: 510 SLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFW 650 SL +L G Y T M+ E +Q+L+DDHFLF+ D+ A+ FW Sbjct: 95 SLGDDLAGNLYRHTTMTDEERQKLVDDHFLFRGKDKMQAASGYHEFW 141 >SB_8138| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 383 Score = 46.4 bits (105), Expect = 2e-05 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +1 Query: 256 ESYSVFAELFDPIIEDYHNGFK-KTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSL 432 ESY F + + P+I+ YH GF T KH + + D A ++STR+R R+L Sbjct: 101 ESYDDFKDFYYPVIQAYHKGFDINTSKHVTDMDPEKISTELSDSAKAKIISTRIRVARNL 160 Query: 433 EGYPFNP 453 +P NP Sbjct: 161 SMFPLNP 167 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +3 Query: 510 SLEGELKGTFYPLTGMSKETQQQLIDDHFLFK 605 SL +L G Y T M+ E +Q+L+DDHFLF+ Sbjct: 187 SLGDDLAGNLYRHTTMTDEERQKLVDDHFLFR 218 >SB_47199| Best HMM Match : ATP-gua_PtransN (HMM E-Value=9.6e-15) Length = 132 Score = 32.3 bits (70), Expect = 0.35 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +2 Query: 113 SLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 220 +++ ++LT E++ L ++KTS G TL IQ GV+N Sbjct: 77 NIMARHLTPEMYVHLCDRKTSNGFTLDQAIQPGVDN 112 >SB_54283| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.4e-13) Length = 490 Score = 31.1 bits (67), Expect = 0.81 Identities = 19/50 (38%), Positives = 28/50 (56%) Frame = +1 Query: 358 VDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTL 507 V G LD VVS RVR RSL+G+PF + ++ +E+++ V L Sbjct: 279 VGVTGTLDA---HVVSCRVRVVRSLQGFPFAWVCSPNERREIQNVVKQAL 325 >SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) Length = 322 Score = 31.1 bits (67), Expect = 0.81 Identities = 19/50 (38%), Positives = 28/50 (56%) Frame = +1 Query: 358 VDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTL 507 V G LD VVS RVR RSL+G+PF + ++ +E+++ V L Sbjct: 270 VGVTGTLDA---HVVSCRVRVVRSLQGFPFAWVCSPNERREIQNVVKQAL 316 >SB_5784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +2 Query: 509 QPRGRAQGHVLPPHRHVEGDPAAAHRRPLPVQ 604 QPR R + P RH EGD AH PL VQ Sbjct: 60 QPRLRPSPYAADPARHGEGD---AHTEPLEVQ 88 >SB_14239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 706 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +3 Query: 468 PVQGDGGQGLRHPVSLEGELKGTFYPLTGMSKE-TQQQLID 587 PV+G G G + ++ G ++G ++ TG KE + QQ+ID Sbjct: 326 PVRGQGICGSCYALAAVGAVEGAYFMKTGKLKELSAQQVID 366 >SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) Length = 385 Score = 28.7 bits (61), Expect = 4.3 Identities = 21/65 (32%), Positives = 31/65 (47%) Frame = +2 Query: 32 KAATMVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSG 211 KAA + + L KL AG++ L D+ L + LT E LK K S + +Q Sbjct: 195 KAAVQLLKSVLPKLTAGYADLYHGDA---LVEVLTTEWHGDLKEKYPQDVSGIYQLVQGQ 251 Query: 212 VENLD 226 +E+ D Sbjct: 252 LESRD 256 >SB_6151| Best HMM Match : Extensin_2 (HMM E-Value=2.6) Length = 287 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 527 QGHVLPPHRHVEGDPAAAHRRPLPVQGG-RPLPAGRQRLPLLA 652 Q H +P H V+ PA A P+P P+PA Q P A Sbjct: 226 QVHPIPAHAQVDPIPAHAQVNPIPEHAQVDPIPAHAQANPATA 268 >SB_2246| Best HMM Match : G-patch (HMM E-Value=5.5e-11) Length = 396 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +2 Query: 536 VLPPHRHVEGDPAAAHRRPLPVQGGRPLPAGRQRLP 643 + PP +E +P + P P GRPL G + P Sbjct: 190 IAPPSSLLESEPIVPQKEPDPSIDGRPLVTGDKEKP 225 >SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2174 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 446 KGYPSSERPQRTRVETTNS-PAGSRLPSVSTSP 351 +G SSERP+R+R T + P S LP +++P Sbjct: 1178 RGSLSSERPERSRRRRTETEPRDSSLPCTASTP 1210 >SB_35966| Best HMM Match : CpaB (HMM E-Value=3.6) Length = 277 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/40 (37%), Positives = 28/40 (70%) Frame = -1 Query: 163 VLQAVEYFPGKVLLQQRLRVGSLELAETSLQFLEGCGVDH 44 + +AV P +V+L R+++GS +LA+ L+ L+G G++H Sbjct: 204 ITRAVIDGPLRVVL--RVQIGSCDLADEHLRKLDGGGLEH 241 >SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) Length = 362 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 237 PTPESKFSTPDWMQSRRVDPNEVFLFFRLSNTS 139 P P+ KFS P + SR +D E L F L+ S Sbjct: 5 PKPKEKFSEPVIIASRNLDSVEARLAFNLTTVS 37 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 554 AGEGVERALELALEADRVPETLSSISLYWDSVR 456 AGE ++ A + A E D + E ++ IS WD ++ Sbjct: 3691 AGESLKEASQSAEEQDNLDEKVADISRRWDELK 3723 >SB_48991| Best HMM Match : Rad52_Rad22 (HMM E-Value=5.2e-12) Length = 353 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 74 EAGFSKLQGSDSKSL-LKKYLTREVFDSLKNKKTSFGSTLLDCI 202 + G+ +G SK+L L+K V D LK +FG L +C+ Sbjct: 30 DVGYGVSEGMKSKALSLEKARKEAVTDGLKRALKNFGQALGNCV 73 >SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) Length = 809 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 198 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 85 Q R D N V++ +R L F DL+ PWS+L Sbjct: 65 QDRAADKNHVYISYR-DCKKLDEEAFPEDLDEAPWSVL 101 >SB_25447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 752 Score = 27.9 bits (59), Expect = 7.6 Identities = 19/60 (31%), Positives = 27/60 (45%) Frame = -3 Query: 560 RHAGEGVERALELALEADRVPETLSSISLYWDSVRQGLKGYPSSERPQRTRVETTNSPAG 381 R + G ERA + E+DRV E+ ++ VR+G +GY R SP G Sbjct: 324 RKSPRGSERARKGTRESDRVRESPKG----YERVREGTRGYERVLEGTRESERVRESPRG 379 >SB_3503| Best HMM Match : Rad52_Rad22 (HMM E-Value=1e-24) Length = 398 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 74 EAGFSKLQGSDSKSL-LKKYLTREVFDSLKNKKTSFGSTLLDCI 202 + G+ +G SK+L L+K V D LK +FG L +C+ Sbjct: 75 DVGYGVSEGMKSKALSLEKARKEAVTDGLKRALKNFGQALGNCV 118 >SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) Length = 617 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 9 LTVVQVPEKPQQWSTPQPSRNWRLVSASSRDPTLS 113 LT V+VP+ Q +T RN + S+S+ DP L+ Sbjct: 534 LTAVEVPKPGDQDTTLDKERNNSVTSSSTPDPPLT 568 >SB_24839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 9 LTVVQVPEKPQQWSTPQPSRNWRLVSASSRDPTLS 113 LT V+VP+ Q +T RN + S+S+ DP L+ Sbjct: 70 LTAVEVPKPGDQDTTLDKERNNSVTSSSTPDPPLT 104 >SB_3| Best HMM Match : Peptidase_C21 (HMM E-Value=5) Length = 186 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 259 SYSVFAELFDPIIEDYHNGFKKTDKHPPKNW-GDVDT 366 +Y + F+P +DY NG++ TD H W G++ T Sbjct: 89 TYEQISITFEPY-QDYANGYRATDLHGKVAWVGELST 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,062,687 Number of Sequences: 59808 Number of extensions: 360480 Number of successful extensions: 1465 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1454 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -