BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00104 (727 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 7.7 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 7.7 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 21 7.7 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 21 7.7 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.4 bits (43), Expect = 7.7 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 121 PVNCWACSSNVNPLCNDPFNIRIDTGNS 204 P N C + PLCND N + G S Sbjct: 144 PENVDGCQKH--PLCNDDPNGNVPLGKS 169 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 7.7 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 236 MLELPFLFDSFEVC 277 + +PF+FDS +C Sbjct: 285 LASVPFIFDSIHLC 298 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.4 bits (43), Expect = 7.7 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 652 FASIRFRYDEFFQTADYVNNVRLVI*TIFIFKVLF 548 F +I F +FFQ + N +L IFIF +F Sbjct: 71 FWTILFSRSDFFQQFECDNEPKLRHYLIFIFVNVF 105 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 21.4 bits (43), Expect = 7.7 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 236 MLELPFLFDSFEVC 277 + +PF+FDS +C Sbjct: 303 LASVPFIFDSIHLC 316 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,631 Number of Sequences: 336 Number of extensions: 2924 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -